KEGG   Anolis carolinensis (green anole): 100562822
Entry
100562822         CDS       T01608                                 

Gene name
egf
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04020  Calcium signaling pathway
acs04068  FoxO signaling pathway
acs04510  Focal adhesion
acs04540  Gap junction
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100562822 (egf)
   04012 ErbB signaling pathway
    100562822 (egf)
   04068 FoxO signaling pathway
    100562822 (egf)
   04020 Calcium signaling pathway
    100562822 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100562822 (egf)
   04540 Gap junction
    100562822 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100562822 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acs04052]
    100562822 (egf)
Cytokines and growth factors [BR:acs04052]
 Growth factors
  Growth factors (RTK binding)
   100562822 (egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA EGF DUF5050 cEGF EGF_3 SGL hEGF
Other DBs
NCBI-GeneID: 100562822
NCBI-ProteinID: XP_008110315
LinkDB
Position
5
AA seq 1055 aa
MFLFLTFIWHVVGTISLISLSAQEHWTTCPIGYRKENLSCKDIDECLEGGVGICGQNCIN
TPGSYMCSCMPGYTLANDKKSCHISVSTPFLVFSQGNAIFGIEADGTHHQKMVTDTGLSV
LLDYHYGEEHIYWLDTEKGLLQRISLNGSNPETICYTGKDISGFAVNWINQNIYLAHYQE
ATIEAISLDGNYSQILAKDDHHPTSIAVDASRRILFWSSEGAFSSIYGAVLDRKEVWRVL
RSTGKIRSISLDFLNQKLFWMQYNVGNDEITHIRSCSYDGSSVHLHKQIIRNQVYDIFIF
ADHIYYSDSTGAIRRANKYTGKDVVAMNLQPASSQPAEILVVHPLKKISMGVDSQTLVER
PCLSNRRNCKRSTCKQDPKTSQCECMSGFTLSKKRKSCEDVNECALWNHGCTLGCVNIPG
SYYCTCPRNFILLSDKKTCYELIPCASNYIQCSHGCGQTPEGPVCFCPEESVLQADGRTC
LGSKPFLLFANSRDIRRIGFDGTDYSSILSWQMGAVLALDYDPVENKIYFAHTALKWIER
TNLDGTDRKKVIHEATQRPEGLTVDWINRKLYWTDPGKFCIESSNLNGKQRKIIIQEEMS
HPRGIAVHPFTEQIFWTDLGINPRIESSSLQGSNRRIIANSNLLWPSGITIDYFADKLYW
CDARKSVIETSNLDGSKRQILTQNDVGHPFGIAVFEDYIWLSDWSKPSLLRMDKKTGLDR
VRLGGSMLRPSSLSIIHPFAKPGHMFMSKDGVPVNKMLVPDTFPQYPLDNSASRDSIKQD
LQTKQELTAEIMVSNRDHCTWLGCDINAQCISNEGGATCQCQKGFVTKGQLCYDLDECAS
SLDQCNRSLSICINTEGGYFCECLVGYTEDGLHCSESAIPATTVSRDKTTSSEQDNPIEC
PPSYCLNEGVCVYFSALQAFACKCEKGYLGERCQFSDLEWWTQQHVMQAKKQNIATAACL
AVLFMLLLIGIVTFYCYSRQKRLYGKKPCGEPIRDTSSSAGGSSKSTDSENTNLQTEKPL
LIVMMECDDNNKDRSSDETDCSTEELHYFCLSEAS
NT seq 3168 nt   +upstreamnt  +downstreamnt
atgtttctctttctcacatttatttggcatgtcgtcggtacaataagtttgatcagtctg
tcagctcaagaacactggacaacatgtcctattggataccggaaagaaaatttatcttgc
aaagatattgatgaatgtttagaaggtggagttggcatctgtggtcaaaattgtatcaat
actccaggatcctatatgtgctcttgtatgccaggctatacattggctaatgacaagaag
tcttgtcatataagtgtttccactccatttctagttttcagccaaggcaatgctatcttt
ggaattgaggcagatggaactcatcaccaaaaaatggtgactgatactggcttatcagta
ttactagattaccattatggtgaagaacatatctattggttggacacagaaaaaggtctt
ctccagcgaatatccttgaatggctcaaatccagagacaatttgctatactggaaaagat
atatctggatttgcagtaaactggataaaccaaaatatttatttggctcattatcaagaa
gccacaattgaggcaatcagcctggatggaaactactctcaaatccttgcaaaagatgat
catcatcccacaagtattgctgttgatgcaagcagaaggattctattttggtcttctgaa
ggagcttttagcagcatctacggagcagttctggatagaaaagaagtttggagagtttta
aggagcactggaaaaatccgaagcatctcactagattttcttaatcagaagcttttttgg
atgcagtacaatgttggcaatgatgaaattacacatatcagatcctgtagctatgatggt
agttctgttcatttgcacaaacagatcatacgaaaccaagtctatgacatctttatcttt
gctgaccatatatattattctgactcaactggtgctatccgacgggccaataaatacaca
gggaaagatgtagttgcaatgaacctgcaacctgcaagttctcaacctgctgaaatactg
gttgtacatccattaaagaagatcagcatgggggtggattctcaaacacttgttgaaagg
ccttgtctttcaaacagaaggaactgcaagagaagcacctgtaagcaagaccccaagacc
agtcaatgcgaatgtatgagtgggttcactttaagcaaaaagagaaaatcatgtgaagat
gtcaatgaatgtgcattatggaaccatggttgtactttaggctgcgtcaatattccagga
tcctattattgtacttgtccaagaaattttattctgctgtctgataagaaaacttgttat
gaattaattccctgtgcaagcaattacattcagtgcagtcatggttgtgggcagacacct
gaagggcctgtttgtttttgtcctgaggaatcagttctccaagcagatggaagaacatgt
ttgggatccaagccatttctgttgtttgcaaacagccgagacatccgccgcattggtttt
gatggaacagattactcaagtattctcagctggcagatgggagcagtcttagctctggac
tatgaccctgttgaaaataagatttattttgcacacacggctttgaagtggatagagaga
actaatctggatggcacagatcgtaaaaaagttatccacgaagcaacccagagacccgaa
ggacttactgtggactggattaaccgcaaattgtattggactgaccccgggaagttctgt
attgaaagcagtaacctcaatgggaagcagaggaaaataattattcaggaggagatgtct
caccctcgaggaattgctgttcatcctttcactgagcaaatattttggactgacctaggc
atcaacccaaggattgaaagttcttccttacaaggctccaaccgacgtattatagcaaac
tcaaatttgctttggcccagtggaataacgattgattattttgctgacaagttgtattgg
tgtgatgcaagaaagtctgtgattgaaacctcaaacctggatggttctaaacgacaaata
ctcacacagaatgatgtaggtcatccatttggcatagcagtgtttgaggattatatttgg
ctctctgactggtcaaagccttcattattgagaatggacaagaagactggccttgacaga
gtgcgccttggaggcagcatgctgagaccctcctcactgagtattatccatccttttgca
aaaccaggccatatgtttatgtcgaaagatggtgtcccagttaacaagatgcttgtgccg
gatacattcccccagtatcccctggacaacagtgcatccagagatagcataaaacaagat
ctacagacgaaacaggagctgactgcagaaatcatggtgtccaaccgggaccattgtaca
tggttgggatgtgacatcaatgcccaatgtatttcaaatgaaggtggtgctacttgtcaa
tgccagaaggggttcgtcacaaaaggccaattgtgctatgatctggatgagtgtgcttcc
agtttggaccagtgcaaccggagcttatcaatatgcatcaatactgaaggtggctacttt
tgtgaatgtcttgtgggatatacagaagatggccttcattgttctgaatctgccatacct
gctaccactgtgagcagagataagaccacatcatctgaacaggacaatcctattgagtgc
ccaccatcgtattgtctcaatgaaggagtttgtgtttatttttcagcacttcaagctttt
gcgtgcaagtgtgagaaaggatatctgggagagcgttgccagttcagtgacctggagtgg
tggacacagcagcatgtgatgcaagcaaagaaacagaacattgccaccgcggcttgcctg
gctgtgttgtttatgcttctcctcattggaattgtaactttctactgctacagtagacaa
aagaggttatacgggaagaaaccctgcggagaaccaatcagagatactagcagcagtgcc
ggtggtagcagcaaaagcactgacagcgaaaatacaaatcttcaaaccgagaagcctctg
ttaattgttatgatggaatgtgatgacaacaacaaagacagatcaagtgatgaaacagat
tgcagtacggaagaacttcattatttttgcctctctgaagcctcatga

DBGET integrated database retrieval system