KEGG   Anolis carolinensis (green anole): 100562840Help
Entry
100562840         CDS       T01608                                 

Gene name
suv420h2
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100562840 (suv420h2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100562840 (suv420h2)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100562840 (suv420h2)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100562840 (suv420h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100562840
NCBI-ProteinID: XP_003225920
LinkDB All DBs
Position
Un
AA seq 569 aa AA seqDB search
MGSTRVTAKELCEIDDLATTLILDPYVGFKTHKMNVSPLPAIRRKHHLREAVEAFRKRKD
LEAAYQTLMQGGWACQYFANRSRQQEAAFKTHIFRYLRIFLPESGFVIKRCNRYSLEING
ARVVSAKSWRKNDKLELLEGYIADLTEQDESLLRTGENDFSVMYSTRKQSAQLWLGPASF
INHDCRPNCKFVPMDGNIACVKVLRDIEPDDEITCFYGDGFFGENNELCECYTCERKGGG
AFRLLNQTPSPSISDNEKYLLRETDGRLQRWKNQSCKLAQRSGKVGRKTRRRRARLRGTL
RRSSIRWYFRMLKPLYIPVHDCLACSAHRCKIHKQLLVRLIRCPPSMLPVSHLRHSRRSR
VQQDYSFMKKHNMTWLDRRSLVVNLGKRVPLDWVGLQTDKVSENGDHQLHSSNVELSQGI
EEHPTGTVENHTEVTEPLASGEQAPFRSSDPLSSSQLLYRTRSMARRQAKLLPKSQLALP
AVDPKLAQYAHVNLEVPPLEGSEHWEQPPPDPLEKEQVEEQVEEQVEEQPPPKQMVSFPP
FVPPKRLRLVVSHGSINLEMASGSCEELS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggttccactcgggtgactgcaaaggaactatgtgaaattgatgacctggctacaaca
ctcattcttgacccttacgttggctttaagactcataaaatgaacgtcagcccactgcca
gccatcagaaggaagcaccatttgcgagaagcagtagaagctttcaggaagcgcaaggac
ctcgaagcagcatatcagaccctcatgcagggtgggtgggcctgccagtactttgcaaac
cggagccgtcaacaggaggctgccttcaagactcatatatttcgttaccttcgtattttc
cttcctgaaagtggttttgtcatcaagcgctgtaaccgatattccctggaaataaatggt
gcccgggtggtctctgcaaaatcatggagaaagaacgataagttagaactcctggagggt
tacattgcagacctgacagaacaagatgagagcctcctgcggacaggcgaaaacgacttc
agcgtcatgtactccacacggaagcagagtgcccagctgtggctgggacctgcatccttc
attaatcacgactgtaggccaaattgtaagtttgtcccaatggatggaaacattgcctgc
gtcaaggtgctgcgggacattgaaccagacgatgagatcacctgcttctatggtgatggc
ttctttggggagaacaatgaattgtgcgagtgctacacttgtgaaaggaaggggggagga
gccttccgcctcttgaatcagacaccatctccatctatctcagacaatgagaaatacctg
cttagggagaccgatggccgtcttcagcggtggaaaaaccagtcatgcaagttggcacag
cgcagtgggaaagtaggacgtaagactcggcgcaggagggcacgattacgtggtacttta
cgtagatcttctattcgctggtactttaggatgctaaagcctttatacatcccagtacat
gactgcttggcctgcagtgcacatagatgtaagattcataagcaactcctggtacgtctg
attcgctgtcctccttctatgctccctgtatcacatctccggcattcgaggcgctcaagg
gtccaacaggattactccttcatgaaaaagcacaatatgacctggttagaccggcgcagc
ttggttgtgaatcttggcaagagggtacccttggactgggtagggttgcagacagacaaa
gtatctgagaatggggatcatcaactacacagcagcaatgtggaacttagccagggaatt
gaggagcatcccacaggaactgtggagaatcacactgaggtcacagaaccacttgcctca
ggagaacaagccccattcaggtcttcagaccctctttcctctagccagctactctacaga
acaaggagcatggccaggaggcaagctaagcttttgcccaaatcccagctggctctacca
gcagtagaccccaagcttgctcagtatgctcatgtcaaccttgaggttccccccttagaa
ggcagtgagcactgggaacagcctcctccagacccattggagaaggaacaggtagaggag
caggtagaggagcaggtagaggagcagcctcctcccaagcaaatggtctccttccctccc
tttgtgccacccaaacggctgcgactggtggtgagccatggctctatcaaccttgagatg
gcgtcaggctcttgtgaggagctgtcttaa

DBGET integrated database retrieval system