KEGG   Anolis carolinensis (green anole): 100562847Help
Entry
100562847         CDS       T01608                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00040  Pentose and glucuronate interconversions
acs00051  Fructose and mannose metabolism
acs01100  Metabolic pathways
Module
acs_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100562847
   00051 Fructose and mannose metabolism
    100562847
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100562847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 100562847
NCBI-ProteinID: XP_008118911
LinkDB All DBs
Position
Un
AA seq 358 aa AA seqDB search
MAASGKSEKGNLSVVVHRAGDLRLEDRPVPEPGPNEVLLKMHSVGICGSDVHYWQHGRIG
DFVVKSPMVLGHEASGTVVKVGSAVTHLKNGDRVAIEPGVPREKDEYCKTGRYNLSPTIF
FCATPPDDGNLCRYYKHDASFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSKVFI
CGAGPIGLVTLLIAKVMGASQVIISDLSASRLEKAKEIGADFTIQVKGESPEELAQAVKN
ALGCMPDITLECTGAQACIQTGIYVSIFKLTHIEIIRSWQSNVFPLELASQLLYASSIWI
GDLTSKIDQQQTQFLKSLFQLPRCVPYCVFLLKSREIPLSIKPGGGHLNIGSRPEFSV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcggggaagagcgagaagggcaacctctctgtggtggtgcaccgggccgga
gacctgcgcctggaagatcgaccagtccctgaaccgggacctaatgaagtgcttctaaag
atgcattctgtcgggatctgcggctctgatgtgcactattggcagcatggacggattgga
gattttgttgtgaagagcccaatggtgctgggccacgaggcctcaggaacagttgtcaaa
gtgggatctgcagtaacacatttaaaaaatggtgacagagtggcaattgaacctggggtt
ccccgggaaaaggatgagtactgcaaaacggggcgctacaacctctccccaaccatcttc
ttctgtgcaacccctccagacgatggaaacctgtgccgctattacaagcatgatgccagc
ttttgctacaagcttccagataatgttacgtttgaagaaggagccctcattgagcccctt
tctgttgggatccatgcttgcagaagggctggagtgactctgggaagcaaagttttcatt
tgtggtgctggtcctattgggcttgtgactttgctgatcgctaaggtaatgggagcttca
caagttattataagtgatcttagtgcctctcgtcttgaaaaggctaaggaaattggggct
gatttcaccatccaggtaaaaggcgaaagccccgaggaattggcccaggccgtgaaaaat
gcacttggttgcatgcctgacattacgctggagtgcactggagctcaggcctgtatccaa
actggaatatatgtgagcatctttaaactgacccatatagagataattagatcttggcaa
agtaatgttttccccctagaactcgcttcccagctactgtatgcttccagcatctggatc
ggtgacttaacatccaaaatagaccaacagcaaacacagtttttgaagtccctcttccag
ctccccagatgtgttccatactgtgtgtttctacttaaatccagagaaataccattgtca
ataaagcctggtggggggcacttaaatattggctcacgaccagagttttcagtctag

DBGET integrated database retrieval system