Anolis carolinensis (green anole): 100562967 Help Entry 100562967         CDS       T01608                                  Symbol cldn1 Name (RefSeq) claudin 1   KO K06087   claudin Organism acs  Anolis carolinensis (green anole) Pathway acs04514   Cell adhesion molecules acs04530   Tight junction Brite KEGG Orthology (KO) [BR:acs00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     100562967 (cldn1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     100562967 (cldn1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acs03037]     100562967 (cldn1)    04147 Exosome [BR:acs04147]     100562967 (cldn1) Cilium and associated proteins [BR:acs03037]  Other cilia and associated proteins   Stereociliary proteins    100562967 (cldn1) Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    100562967 (cldn1)   Exosomal proteins of colorectal cancer cells    100562967 (cldn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF1218 Cytochrom_B_C ThrE TctB CD20 Motif Other DBs NCBI-GeneID:  100562967 NCBI-ProteinID:  XP_016852419 Ensembl:  ENSACAG00000000655 LinkDB All DBs Position Un Genome browser AA seq 128 aa AA seqDB search MVASILLGLIASFVAMIGMKCMKCLEDDEVKKMRMAVLGGIIFLVSGFATLVATSWYGNV IAQEFFNPYTPVNTRFEFGPALFVGWAAASLVLLGGAFLCCSCPRKETSYPPTRPYPKSA PSAGKDYV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggtggccagcatcctcctgggtctcattgcctcctttgtcgccatgattggcatgaaa tgcatgaagtgcctggaggacgatgaagtcaagaagatgcggatggcggtcctcgggggc atcatcttccttgtctcagggttcgccaccttggtagccacatcatggtatggaaacgtg atcgcccaggagtttttcaacccatacactccagtcaataccaggtttgagtttgggccg gcgctctttgtgggctgggcggcggcctcgctggtcctcttgggcggggccttcctgtgc tgctcgtgcccccggaaggagacctcctaccccccgacccggccttaccccaaaagcgcc ccgtccgccgggaaggattacgtataa

DBGET integrated database retrieval system