KEGG   Anolis carolinensis (green anole): 100563034Help
Entry
100563034         CDS       T01608                                 

Gene name
gys1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00500  Starch and sucrose metabolism
acs01100  Metabolic pathways
acs04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100563034 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100563034 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acs01003]
    100563034 (gys1)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100563034 (gys1)
Glycosyltransferases [BR:acs01003]
 Polysaccharide
  Storage polysaccharide
   100563034 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 100563034
NCBI-ProteinID: XP_003225280
Ensembl: ENSACAG00000004713
UniProt: H9G9K0
LinkDB All DBs
Position
Un
AA seq 732 aa AA seqDB search
MPLARSLSVTSLTGLEDWDDELDLDNAVLFEVAWEVANKVGGIYTVIQTKAKITLDEWGE
NYFLIGPYLELNVRTQVELIEPPNPAIRRTIDSMNAKGCKVYFGRWLIEGGPYVILIDIG
ATAWSLDRWKTELWESCSIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEETPFIIGHFH
EWLSGVGLFLCRIRKLPVATIFTTHATLLGRYLCAGSVDFYNNLQTFNLDKEAGDRQIYH
RYCMERAAVHCTHVFTTVSQITAVEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTIFFFIAGRYEYSNKGADIFLEALARLNYLLRVNGSQT
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANAVKEKFGKKLYESLLVGNLPDMNKML
DKEDFTMMKRAIFATQRQSFPPICTHNMLDDSTDPILNSIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRGLDESCTQLTSFLYSFCQQTRRQRIIQRNRTERLSDLLDWKY
LGRYYMYARHMALAKAFPDNFTYEPHEPTAAQGFRYPRPASVPPSPSVSRHSSPHHSETE
EDDERYDEEEEAEKDRQNIKPPGMMGPIPEWRKRSKKGSSEASTSSNASTPTIPSSPSDL
SSPTNSLIEERN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcccgcagcctctcggtgacctccctgacgggcttagaggactgggacgat
gaacttgacttggataatgccgtcctctttgaagtggcttgggaggtggccaataaagtt
ggtgggatttacacggttatccagaccaaggccaagattacactggatgagtggggtgag
aattacttcctgatcgggccttacctggagttgaacgtccgcacacaagtggagctcata
gagccacccaaccctgccatccgccgtacaattgactccatgaatgcaaaaggatgcaaa
gtttattttggtcgctggctgattgaaggggggccctatgtgattctcattgatatcgga
gccactgcctggagcttggatcgctggaagacagaactctgggaaagctgctccattggg
attccttggtacgaccgagaggcaaatgatgccgttctctttggcttccttactgcctgg
tttcttggggagttttccgcacaatgtgaggagacgccgttcatcatcggtcatttccac
gagtggttgtctggggttggtcttttcctctgcaggatccggaagcttccggtggctacc
atcttcaccacccatgccactttgcttgggcgctacttgtgcgccggaagtgtcgacttc
tacaataatctccaaacttttaatttggacaaggaggctggggaccgacagatctaccat
cgttactgtatggagcgggctgctgtccattgcacgcatgtttttaccacagtctcccag
atcacagctgtggaagctgaacacttgttgaaaaggaaaccagatattgtgactcccaat
ggtctaaacgtcaagaaattttctgccatgcacgaattccagaacctccatgcccagagc
aaggcgcgtatccaggagtttgtccggggccacttctacgggcacctggacttcaatctg
gacaagaccatcttcttcttcatcgctgggcgctatgaatattccaacaaaggggctgac
attttcttagaagcccttgcccgcctcaactacctgctgagagtaaatggtagccagaca
acagtagtggccttcttcattatgccagccaggaccaacaacttcaatgttgagactctg
aaaggccaagccgtccgcaagcagctctgggatacagctaatgcagtgaaagaaaagttt
ggcaaaaagctctacgagtcactccttgtagggaatcttcctgatatgaacaaaatgctg
gacaaggaggatttcacgatgatgaagagagccatctttgccacccagcgccagtctttt
cccccaatctgcacccataacatgctggatgattccaccgaccccattctcaacagcatc
cgccgcattggcctttttaacagcagtgccgatcgcgtcaaggttatcttccacccagaa
ttcctgtcttccactagtcctctccttccagttgattatgaggaatttgttagaggctgc
catttaggggtgttcccttcttactacgagccatggggctacacaccagctgaatgcact
gtgatgggcatccccagtgtttccaccaacctctctggctttggctgctttatggaggaa
cacatagcagatccatctgcctatggaatctacatcctcgaccgacgttttcggggcttg
gatgagtcttgcacacagctgacctcttttctgtacagcttctgtcagcaaacacggcgg
caacgcatcatccagcggaaccgcaccgagcggctttctgatctcttagactggaaatat
ctaggccggtattacatgtacgcaagacacatggcactcgctaaggcattccctgacaac
ttcacctatgagccacatgagccaacagcggctcagggcttccgctacccacgcccggcc
tcggtgccgccatctccctccgtctcccgccactccagtccccaccacagcgagaccgaa
gaggatgatgaacggtacgatgaggaggaggaagcggaaaaggaccggcagaacatcaag
cccccgggcatgatgggccccatccccgagtggcgcaagcgctccaagaaaggatccagc
gaagccagcacgtcctccaatgccagcacccccaccattcccagcagccccagcgacctc
agcagccccaccaactctctgatcgaagagaggaattag

DBGET integrated database retrieval system