KEGG   Anolis carolinensis (green anole): 100563103Help
Entry
100563103         CDS       T01608                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100563103 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100563103
NCBI-ProteinID: XP_016852585
Ensembl: ENSACAG00000015002
LinkDB All DBs
Position
Un
AA seq 791 aa AA seqDB search
MSMRICCHGDGEYPAFGARRGRGVPRQPKRQRGCRCTTEHLEAAIGLRALALSRPSRLCT
EVSPHSWLGVECIKSIGCLLGLSGSRCRYGTDVAKIQCFLSLCVFEDVLEVLEVRTFNRE
HEINKKEHHTDKYSNHKLIVRRGQPYHIQISFNRPYNPEKDTFWIEYLIGRYPQQAKGTY
IKVQLVEKLQSKEWGAKITHSDGQFVALNIMPAANCVVGKFRMYIAISTPIGILRTRRNP
ATDTYILFNPWCTEDLVYLDDEKQRQEYVLNDLGVIFYGDPENIRSRSWNYGQFEEGVLD
ACLYVMDRAELDLSGRWNPLKISRVGSAMINAKDDEGVIVGSWSNVYDYGVAPSAWTGSV
DILLEYHSSREPVRYGQCWVFAGVFNTFLRCLGIPARVVTNFCSAHDNDANLQMDVFVDE
NGKVDSKLTKDSIWNYHCWNEAWMSRPELPVGFGGWQAVDSTPQENSDGMYRCGPASVQA
IKHGHVCFPFDTPFVFAEVNSDVVYSKAMQNGVKLVQHVDKTQIGRLIVTKEEGTDKMKI
ITEQYKFQEGTEEERLALETALMYGVKKSIPQDVTSTLEVNMDFVVEDPTLGSDFNVTIT
FQNNTQSRYTATSYLSGNIVFYTGVSKNEFKNHSFNVTLEPMKAQTVEVLIKSSEYMSQL
LEQASLHFFVTARVNETQKILAQQKSVALKIPQLLLKVPGEKVVGKDMAVIVEFTNPLKE
DLNNVWVRLDGPGLLKPTSKLFREVPRNSTLTWEEKCLPKRAGLRKLIASLNCDALRHVY
GELDINIQSAV
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgagaatctgctgccatggagatggggaatatcctgcctttggtgccaggaga
ggaaggggagtgccccggcagcccaagcgccaaagaggatgccgctgcaccactgaacat
ttggaggccgcaataggccttcgtgcccttgcactcagcaggccctcgcgcttgtgcact
gaagtctcgccacactcgtggctgggagtggagtgcatcaagtccatcggctgccttctg
ggactctctggatccaggtgcagatatggcacagatgtagctaaaatacaatgtttccta
tctctttgtgtctttgaagatgtcctggaagtcctggaagtccgcaccttcaaccgtgaa
catgaaattaataaaaaggagcaccatacagacaagtactccaaccataagctgattgtg
cgccgaggccagccataccatatccagatttctttcaaccgcccttacaatccagaaaaa
gacacattttggattgaatatttaatagggcgatacccacaacaagctaaaggcacctac
atcaaagtccaattggtcgaaaaactgcaaagtaaggaatggggtgccaagatcacccac
agtgatgggcagtttgtagccctgaatatcatgccagctgcaaactgcgttgtggggaaa
ttccgcatgtacattgcaatctcaactccaatcggcattctgaggacgagacgaaaccca
gccacagacacatatatactgtttaacccctggtgtacagaggatctcgtttatctggat
gatgaaaaacaaaggcaagaatatgtcctgaatgaccttggggttattttctatggagac
cctgaaaatatcagatccagaagctggaattatggccagtttgaagagggtgttttggat
gcttgcctatacgtgatggacagagcagaactggatctttcaggccgatggaatccactg
aaaatcagtcgtgtgggctctgcaatgattaatgctaaagatgatgagggtgtgattgtc
gggtcatggtccaatgtttatgattacggagttgcaccatcagcttggactggcagtgtg
gacatcttgttggagtatcacagttccagagaaccagtacgatatggccaatgctgggtc
tttgcaggagtgtttaacacatttttgagatgcctggggattcctgcaagagttgtcact
aacttttgctcagctcatgacaatgatgccaacttgcagatggatgtctttgtggatgaa
aatggaaaggtggattccaaactcacaaaagactcaatctggaattaccactgctggaat
gaagcttggatgtccagacctgaacttcctgttggttttggaggctggcaggctgtggat
agcacccctcaagagaacagtgatggcatgtatcgatgcggtcctgcttctgttcaagcc
atcaagcacggccatgtctgcttcccatttgatacaccttttgtttttgcagaggtaaac
agtgatgttgtatactcaaaagcaatgcaaaatggagttaaactggttcaacatgttgac
aagacccagattggtagattaattgtaacaaaagaagaaggcacagataagatgaagatc
atcactgagcaatacaaattccaagaaggaactgaggaagagagacttgctctggagaca
gccctgatgtatggtgttaaaaaaagcatcccccaggatgtcacatccactttggaggtc
aatatggactttgtggtggaagacccgactcttggcagcgatttcaatgtcacgattact
ttccaaaacaatactcagagccgttacactgcaacatcctatctttctggcaacattgta
ttttataccggtgtctcaaagaatgaattcaagaaccacagtttcaatgtgacactggaa
ccaatgaaagctcaaactgtcgaggtgctaatcaagtcgagcgagtacatgagccagttg
ctggaacaagcctccctgcatttcttcgtcacagcccgtgtcaatgaaacacaaaaaatc
ctggcccagcagaagagcgtagctctgaaaatcccccaactgctccttaaggttcctgga
gagaaagtagttggtaaagacatggcagtgattgtggaattcaccaacccattgaaagag
gacctcaacaacgtctgggttcgactcgatgggcctggtctcctgaagccaacctcaaaa
ttgttcagagaggttccaaggaattcaaccttgacctgggaagaaaaatgccttccaaag
cgagctggcctccgaaaactgattgcaagcttgaattgtgatgctttacggcatgtctac
ggggagctggacatcaatattcagagtgctgtgtaa

DBGET integrated database retrieval system