KEGG   Anolis carolinensis (green anole): 100563296Help
Entry
100563296         CDS       T01608                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00512  Mucin type O-glycan biosynthesis
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100563296 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acs01003]
    100563296 (galnt9)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100563296 (galnt9)
Glycosyltransferases [BR:acs01003]
 O-Glycan biosynthesis
  Mucin-type
   100563296 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100563296
NCBI-ProteinID: XP_016852253
Ensembl: ENSACAG00000007493
LinkDB All DBs
Position
Un
AA seq 608 aa AA seqDB search
MALARKIKTLLTLNILVFVGIILFSVYCRLQEHSHELVQIVRSPARPPARSRGPKAQEAP
LDREAILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEY
GYNAQLSDRISLDRSIPDYRPKKCKQMSYPSDLSQISVVFIFVNEALSVILRSVHSVVNH
TPSHLLKEIILVDDNSDNVELKFNLDQYVQKRYPGLVKIVRNNKREGLIRARIQGWKAAT
SPVVGFFDAHVEFNIGWLEPTLMRIREDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWG
LWCMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELG
MRVWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWN
IPMMNPGVDFGDVSERVALRQRLQCRSFKWYLENVYSEMRIYNNTITYGEVRNNKASGYC
LDQGAEDDDKAILYPCHGMSSQLVRYSSEGLLQLGPLGSTTFLPDSKCLMDDGKRRTPVL
KKCEDTLRSAQKLWDFTQVLIGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWVIR
NWIKHGQH
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcccgcaagatcaaaactttgttgacgctcaacatcctggtcttcgtgggc
atcatcctcttctcggtctactgccgcctccaggagcactcccatgagctggtccagatt
gtccggagcccggcccgcccgcccgcccggagcaggggccccaaagcccaggaggccccg
ctggacagggaggccatcctccagcgcctggaccacctggaggaagtggtctacaaccag
ctcaatggacttgccaaaccaatgggattagtggaaggccctggtggcctgggccaagga
ggcatggcagccactttgagagatgacagccatgaatcggaaaccaaatatgaagaatat
ggttataatgcccagttgagtgacaggatttcattggaccgatctattcctgactacagg
ccaaaaaaatgcaaacagatgtcctaccccagtgacctctctcagatctccgtggtcttt
atttttgtcaacgaggctctttccgtcatcttgcgctcagtccacagtgttgtgaatcac
actccatcccacttgcttaaggagattattctggtggatgacaacagtgacaacgttgaa
ttgaaattcaatctggaccagtatgtccaaaagagatacccaggtctggtgaaaatagtt
cgcaataacaaacgggaaggtctgattcgcgccaggatccaaggttggaaagcggccacg
tctccggtggttgggttttttgatgcccacgtcgagttcaacattggctggctagagcca
accctgatgcgcatcagagaagacaggaagcggatcattctcccagcaatagacaacatt
aaatacaacacctttgaggtgcagcagtatgccaatgccgctcacggctacaactggggg
ctttggtgtatgtacatcatcccacctcaagactggctggacaagggggacgaatctgca
cccatcagaacaccagccatgatcggttgttcgtttgtggtagacagagaatattttggt
gagatcgggctgcttgatcctgggatggaagtgtacggaggagaaaacattgagcttggt
atgagggtttggcagtgtggaggaagtatggaggtgttgccttgttcccgcgtggcccat
attgagcgcacaaagaaaccctacaacaatgacattgactactatgcaaagcgcaatgcc
ttgcgtgctgctgaagtctggatggatgatttcaagtcccatgtgtacatggcgtggaac
ataccaatgatgaatcccggagttgactttggagacgtttctgaaagagtcgctttgcgt
caacgtcttcagtgccggagtttcaagtggtacttggagaatgtctactccgaaatgagg
atttacaataataccatcacttatggagaggtacgcaacaacaaagccagtggctactgc
ttggaccaaggagctgaagatgacgacaaagctattctctatccatgccatggaatgtcc
tcccagcttgtccgttacagctctgaaggacttctgcagctgggtcctttgggatcgaca
acctttctgcccgattccaaatgcctcatggacgatgggaaaagaaggactccggtactg
aaaaaatgtgaagacactctgaggtcggctcagaagctgtgggatttcacacaggtatta
attggtccaatcatcagccgagacacagggcggtgtctagaagtagaaatgtccaaggat
gccaattttgggctcagattagtagtacaaagatgctcaggtcaaaaatgggtgatcaga
aactggataaaacatggtcaacattga

DBGET integrated database retrieval system