KEGG   Anolis carolinensis (green anole): 100563772
Entry
100563772         CDS       T01608                                 

Gene name
ccnd1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04218  Cellular senescence
acs04310  Wnt signaling pathway
acs04340  Hedgehog signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100563772 (ccnd1)
   04340 Hedgehog signaling pathway
    100563772 (ccnd1)
   04371 Apelin signaling pathway
    100563772 (ccnd1)
   04068 FoxO signaling pathway
    100563772 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100563772 (ccnd1)
   04115 p53 signaling pathway
    100563772 (ccnd1)
   04218 Cellular senescence
    100563772 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100563772 (ccnd1)
   04530 Tight junction
    100563772 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100563772
NCBI-ProteinID: XP_003214708
Ensembl: ENSACAG00000016001
LinkDB
Position
1
AA seq 292 aa
MDHQLLCCEVETIRRAYQDANLLNDRVLQAMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRYLSFEPLKKSHLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPSELLQMELLLVNKLKWNLAAMTPHDFIEHFLNKMPVAEDSKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSKVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggatcaccagctgctctgctgcgaagtggagaccatccggagagcctaccaagatgcc
aacctcctcaacgaccgggtcctgcaggccatgctcaaggccgaggagacctgctcgccc
tcggtctcctacttcaagtgcgtccagaaggagatcttaccatatatgaggaaaatcgtg
gccacttggatgctggaggtttgtgaggagcagaagtgtgaagaagaagtgttcccctta
gctatgaattatttggaccgatatctctcttttgaacctcttaagaaaagccacttgcaa
ctgctgggagctacctgtatgttcgttgcctcaaaaatgaaggaaaccattcctctaact
gcagaaaaactgtgtatttacactgataactccattagacccagcgaattactgcaaatg
gagctgctcctggtgaataagctgaagtggaacctggctgccatgacccctcatgatttt
attgaacattttctaaataaaatgcctgtggctgaggacagcaagcagatcatccgtaaa
cacgcccagacttttgtggctctatgtgctacagatattaagtttatttcgaatccgcct
tccatgattgccgctggtagcgtggtagcagctgtgcaaggtctccatcttggaaacact
aacacatttctctcttaccaatgcctcacacatttcctatcaaaagttatcaaatgtgat
ccggattgtttacgagcttgccaagaacagatcgagtccctccttgaatctagtctacgc
caagcacaacaacacaacatatcttcagaaacaaagactgttgaagatgaagctgatctt
tcctgcacacccactgatgttagagatgtgaatatttaa

DBGET integrated database retrieval system