KEGG   Anolis carolinensis (green anole): 100563938
Entry
100563938         CDS       T01608                                 

Gene name
perp
Definition
(RefSeq) PERP, TP53 apoptosis effector
  KO
K10136  TP53 apoptosis effector
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100563938 (perp)
SSDB
Motif
Pfam: DUF998 Pox_A14 DUF1422
Other DBs
NCBI-GeneID: 100563938
NCBI-ProteinID: XP_003223330
Ensembl: ENSACAG00000016852
UniProt: H9GNN1
LinkDB
Position
Un
AA seq 192 aa
MVRCGLACWRCRWLLPLLLGLAIILGIIALAGRGWLESAEAPYVRQASLWWDCFKANPGD
LNWACNSLMDYSWGKAAAATYLVGFCILCICFCLAVIAFSIEVLRWNFVRGIGGLLFVVA
AFQILGLVIYPVMYTEDIPLTGSNMFSWAYGFGWASTVMVIGCAFFFCCLPNWEDEVLGN
IKPYGYNDVERM
NT seq 579 nt   +upstreamnt  +downstreamnt
atggtccggtgcggtctggcctgctggaggtgccgatggctcctgccccttctcttgggt
ttagccatcatcttgggcatcattgccttggctggtagggggtggctggagtcggccgaa
gcgccttatgtgcgccaagcatcgctatggtgggactgcttcaaagcaaatcctggtgac
ctcaactgggcatgcaactccctcatggattacagttggggtaaagctgcagctgcgaca
tacctagttggcttttgcatcctgtgtatctgcttctgcctcgcagtcattgcattttcc
attgaagtactgcggtggaactttgttcgaggaatcgggggtttgctgtttgttgttgct
gctttccagatcctaggcttggtcatctacccagtgatgtacacagaagacattcctctg
acgggaagcaacatgttcagttgggcctatggctttggctgggcaagtaccgtgatggtg
atcggctgcgcattcttcttctgctgcctgcctaactgggaagacgaagttctgggcaat
ataaaaccctatgggtacaatgatgtggagcgtatgtga

KEGG   Anolis carolinensis (green anole): 100564136
Entry
100564136         CDS       T01608                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100564136
SSDB
Motif
Pfam: PMP22_Claudin PTR2 PalH EI24
Other DBs
NCBI-GeneID: 100564136
NCBI-ProteinID: XP_003223331
Ensembl: ENSACAG00000028266
UniProt: R4GDF9
LinkDB
Position
Un
AA seq 187 aa
MVRQGLDYTRCRWILPLLAGLAMLFGIIALAGWDWISSQTLPFSQHASLWRICSLQNGWQ
CRSLLDYAWGQGAAGTFMVGFVLVVICFALSIIAFAINTLRFNFVRGIGGIFFVAAVFSL
MALVIYPVMISKYIIFPVGTVNQFGWAYGFGWTMCLMSIGLGFFFCCLPLYEDQILGNVK
PYYYPDI
NT seq 564 nt   +upstreamnt  +downstreamnt
atggtgaggcaagggctggactatacccgctgcagatggattttgcctcttcttgcgggc
ttagccatgctgtttggcatcatagcactggctggttgggactggattagctcgcaaacc
ctgccattttcacaacatgcctccttatggagaatatgctccttacaaaacggatggcaa
tgcaggtcgctcttggattatgcctggggtcaaggtgcagcaggcactttcatggttgga
tttgtccttgtggttatctgttttgccttgtctatcatcgcatttgccatcaacacactt
cgcttcaactttgtgagaggaataggaggcatctttttcgttgctgctgtgttctcacta
atggccctcgtcatctaccctgtgatgatctccaaatatatcatcttcccagtcggtact
gtgaatcagtttggctgggcctatggctttgggtggaccatgtgcctaatgtcaataggc
cttgggttcttcttttgctgcctccccctctatgaagatcaaattttgggaaatgtcaaa
ccttattactatccagatatttaa

DBGET integrated database retrieval system