KEGG   Anolis carolinensis (green anole): 100563997
Entry
100563997         CDS       T01608                                 

Gene name
bid
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04217  Necroptosis
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100563997 (bid)
   04217 Necroptosis
    100563997 (bid)
   04115 p53 signaling pathway
    100563997 (bid)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100563997 (bid)
SSDB
Motif
Pfam: BID Bcl-2 CRM1_C TMEM144 SurA_N_2
Other DBs
NCBI-GeneID: 100563997
NCBI-ProteinID: XP_016849107
Ensembl: ENSACAG00000012534
LinkDB
Position
5
AA seq 188 aa
MMNQVERNDWPDTSTSVLLYSFLQHSRDCTFVSDLNCLKNELLVSRISDDDDDDELQTDG
NRCGRFQAREEVPDEEIFRIIGAQLAEIGDKLTAEIETSVIQNLAQHFRRENMSKEVMTM
QISHVVQELVRKMPLDMEKEKAMLVISMALAKKVVNSVPSLLQQVFNATVNYINQNLHDY
VNNLAPES
NT seq 567 nt   +upstreamnt  +downstreamnt
atgatgaatcaggttgaaaggaacgactggccggatacatctacttccgtccttctctac
tccttcctgcagcactccagggactgcacctttgtttcagaccttaattgtttgaaaaat
gagttattggtttccagaataagtgatgatgatgatgatgacgaacttcagacagatggg
aatagatgtgggagattccaggccagagaggaagtgcctgatgaagaaattttccggatt
atcggagctcagctggctgaaatcggggataagctgactgctgagattgagacatcagtc
atacagaatctggcacagcattttaggagagagaacatgtccaaagaggtgatgacgatg
caaatatctcacgttgtgcaggaacttgtgagaaaaatgcccttagacatggagaaggag
aaagctatgttagtgatatcaatggctttggcgaagaaagtagtaaatagcgtgccttct
cttctacagcaagtgttcaatgcaactgtgaactatatcaaccagaacctccatgattat
gtgaacaacctggctcctgagagctga

DBGET integrated database retrieval system