KEGG   Anolis carolinensis (green anole): 100564298
Entry
100564298         CDS       T01608                                 

Gene name
pidd1, lrdd
Definition
(RefSeq) p53-induced death domain protein 1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100564298 (pidd1)
   04115 p53 signaling pathway
    100564298 (pidd1)
SSDB
Motif
Pfam: LRR_8 ZU5 LRR_4 Peptidase_S68 Death
Other DBs
NCBI-GeneID: 100564298
NCBI-ProteinID: XP_008106536
Ensembl: ENSACAG00000015298
LinkDB
Position
1
AA seq 890 aa
MAGRPELGDPLGEGAWGAEGPVSSCLAGNRLNLDVYAEGCLSFLRLFETRSEEVEQVEFL
RLSCNEEHIASILSIIPALKGLKSLVLKGGHTRDEAGACQRGLLFSLPQELGELTQLAHL
DLSFNNFTALPPCVTKLLSLRSLLISHNSLQELPEDFGQLSELTFFSAMKNQLRDLPQGI
GELVALQTLDLSENALKSLPEEIGNLHSCMELDLSGNLLTGIPASLANLQSLQQLHLHSN
LLVTVPASLAHLPNLSRLDLQNNRLRTIPPEIQSLPFVHLRGNPLGEPEVPLQPENSTSE
EPRRLFIETGESSFIVTPDGCRVSLACGIQLSFPPGATTTSVTIHFQKCFPDPQWVKLKH
HDVLLSKVLELQPHGIGFQKEVQIQMPYASPQSLNDREIIIRTLSGEKWSELGTRVKHKG
KMHFACCSVPHFSWFVVVSRLVENECRVPQEGALLFSTVDPNIKVTFPPGVTEETRTVKL
QVLPVSAEELQEITEDNEMVTSPLLFLSQNSPADFLQPVKIQLPLPPGVTGLTLDRSRVH
LLHGDRNAQNWDDITDQVVLEFTHLYALFEVTHFSWYWLWCTTKSYIDGIAKKVYKRLRM
YQVNFIALQRKKDPEQVLLQCVPKHKVDPVLKKLQDRYRGPEPSDMVEMLEGEQFFAAFE
RGISIDADRPDCIDGRISFNFFSHLKNVKEVYITSEVDRKSTAVKGQVSFYRGAVPENIP
EEVSKRRKGPDSHWLATLPIKLPKLKSQENKQPTTSNGFSLPPLNLGNAETGYLTQSNLL
GIAGRIGADWQTIGLHLGLSYQQIQRIQYNNREDLNTQILDMLFSWAQQNEKKPDCVDQL
ICAMKESDRQDIADEIVAIIALGKQKYRESIRRVGLDQESSTEDSAIAMM
NT seq 2673 nt   +upstreamnt  +downstreamnt
atggcagggcggcctgagcttggggaccccctgggggagggcgcttggggcgccgagggg
cctgtcagctcttgcttggctggcaaccggctcaacttggacgtctatgcagagggctgc
ctttccttccttcggctgtttgagacaagaagtgaagaagtggagcaggtggaattcctg
agactgagctgcaacgaggagcatattgcttccatccttagcatcattcctgctctgaag
ggcctgaaatctcttgtgctcaaaggtggacacaccagggatgaagctggggcttgccag
agaggattgcttttttccttgccccaagagcttggagagttaacccagcttgcccacctc
gatctcagcttcaacaacttcactgcgttgccaccctgtgtcaccaagttactcagcctc
aggagtcttttgatcagccacaacagcttgcaagagctgccggaggactttggccaactc
agtgagctgactttcttctcagcaatgaagaaccagctcagagatctacctcagggcatt
ggagagctggtagcactgcagactttggacctttcagaaaatgcactgaaatcccttcca
gaagagattgggaatcttcatagttgtatggagctggatctctctgggaatctgttgact
ggaatccctgcctcccttgccaatttgcagtctctgcagcagctgcatcttcacagcaat
ctcttggtgacagtccctgcatccttggcccacctccccaacttgtccaggcttgatctg
cagaataacaggctgcgcaccatccctccagagatccagagcttgccctttgtgcatctg
cgaggtaaccctctaggagaacctgaggtgcctctacaaccagaaaattcaacttcggaa
gaaccgagaaggttgtttattgaaactggtgagagcagctttatagtgacccccgatggc
tgcagagtttccttggcttgtggcatccaactttcgtttcccccgggtgccaccactacc
tcagtcactatccacttccaaaaatgctttcctgatccgcagtgggtaaagctgaagcac
catgatgtcttgctgagcaaagtcctggagttgcaacctcatgggattggcttccagaag
gaagtgcagatccagatgccttatgcttcccctcagagtctgaatgatcgtgagatcatc
attcgaaccctcagtggagaaaagtggagtgaactgggaaccagagtgaagcacaaaggg
aagatgcatttcgcctgctgcagtgttcctcacttctcctggtttgtggttgtctcccgc
cttgtggagaacgaatgcagagttcctcaggagggggcactgcttttctcaacagtggac
ccaaacatcaaagtgaccttccctcctggcgtgacagaggagactaggacagtaaaactc
caggtgttgccagtgtcagcagaagagctccaggagatcacagaagacaatgaaatggtc
accagccccctcctcttcctctcccagaattcccctgcggacttcctccagcctgttaaa
attcagctcccgctgccaccaggggtcacaggtctaaccttggatcgttccagagtccat
ctgttgcatggggacagaaatgctcagaactgggatgatatcacagatcaagtggtgctg
gagttcacccatctttatgctttgtttgaagtcacacacttctcctggtactggttatgg
tgcaccaccaaatcctatattgatggcattgctaaaaaggtctataaaagactgcgcatg
taccaagtgaactttatcgctctacaaaggaagaaagacccagaacaagttctgctgcag
tgtgtcccaaagcacaaggttgatcctgttttgaaaaagcttcaggacagatatcgcggt
cctgagccatcagatatggtggagatgcttgaaggagagcagttctttgcagcctttgaa
cgaggcatcagcatcgatgcagatcggccagactgcattgatggaaggatttcattcaac
ttcttctcacatttgaaaaatgtgaaggaagtttatatcacctctgaagtggacaggaaa
agcactgctgtgaaaggacaggtttccttttaccgaggagctgttccagagaacattcca
gaagaagttagcaagaggagaaaaggcccagattcccattggctagctaccttgccaatc
aagctacctaaactgaaatctcaggagaataaacaacctacgacctcaaatggcttctct
cttccccctctgaatttggggaatgcagaaactggctacctcacacagtccaatctactt
ggcattgctggtcgcataggagcggactggcaaactataggcttacacctgggattgtcc
tatcagcagattcagaggattcagtacaacaacagggaagacctcaatactcagattctg
gatatgctcttctcttgggctcagcaaaatgaaaagaagcctgactgcgtagaccagctg
atctgtgccatgaaggagagtgaccgccaagacatagccgatgaaattgtggccataatt
gcactaggaaagcaaaaatacagggagtccatccggagagtgggcctggaccaggagagt
agcactgaagattcagccatcgctatgatgtag

DBGET integrated database retrieval system