KEGG   Anolis carolinensis (green anole): 100564309
Entry
100564309         CDS       T01608                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100564309 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100564309 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acs04052]
    100564309 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:acs00536]
    100564309 (fgf1)
Cytokines and growth factors [BR:acs04052]
 Growth factors
  Growth factors (RTK binding)
   100564309 (fgf1)
Glycosaminoglycan binding proteins [BR:acs00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100564309 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100564309
NCBI-ProteinID: XP_003217424
Ensembl: ENSACAG00000013427
UniProt: G1KNS7
LinkDB
Position
2
AA seq 155 aa
MAEGEITTFTALTERFALPMENYKKPKLLYCSNGGHFLRILPDGKVDGTMDRNDSYIQLL
LTAEDVGVVYIKGTETGQYLAMDANGHLYGSQLPTEECLFVETLEENHYNTYTSKMHGDK
KWYVGLKKNGKGKLGPRTHRGQKAILFLPLPVSPD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggtgaaataacaacattcacagccttgaccgagaggtttgctctcccaatg
gagaattacaagaagcccaaactcctgtattgcagcaatggaggccacttcctgaggatc
cttccagatggaaaagtggatggcaccatggaccggaatgacagctatattcagttgctg
ttaacagcagaagatgtgggtgtggtatatataaaaggcactgagaccgggcagtacttg
gccatggatgccaatggacatttatatggctcgcagttgccaacagaagagtgtttattt
gtggaaacgctggaagaaaaccattacaatacatatacctcaaagatgcatggcgataag
aagtggtatgttggcttgaaaaagaatgggaaaggcaaactggggccacggactcatcgc
ggccaaaaggcaatacttttccttccactgccagtatcacctgattag

DBGET integrated database retrieval system