KEGG   Anolis carolinensis (green anole): 100564375
Entry
100564375         CDS       T01608                                 

Gene name
grb2
Definition
(RefSeq) growth factor receptor bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04150  mTOR signaling pathway
acs04510  Focal adhesion
acs04540  Gap junction
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100564375 (grb2)
   04012 ErbB signaling pathway
    100564375 (grb2)
   04068 FoxO signaling pathway
    100564375 (grb2)
   04150 mTOR signaling pathway
    100564375 (grb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100564375 (grb2)
   04540 Gap junction
    100564375 (grb2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100564375 (grb2)
   04912 GnRH signaling pathway
    100564375 (grb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100564375 (grb2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:acs04990]
    100564375 (grb2)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    100564375 (grb2)
Domain-containing proteins not elsewhere classified [BR:acs04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100564375 (grb2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 SH2_2 hSH3 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 100564375
NCBI-ProteinID: XP_003217257
Ensembl: ENSACAG00000006524
UniProt: G1KFH8
LinkDB
Position
2
AA seq 217 aa
MEAVAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLGKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEEGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNRNI
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccgtcgccaagtacgatttcaaagccaccgcagatgacgagctcagtttcaaa
cgcggggatattcttaaggttttgaatgaagaatgtgatcaaaactggtacaaagcagaa
ctgaatggcaaagatggcttcattcccaaaaattatattgaaatgaaaccacatccgtgg
ttttttgggaagatccctcgagcaaaagctgaggagatgttgggcaaacagagacatgat
ggtgccttcctcatcagagagagtgagagtgctcctggagacttttctctctctgtcaaa
tttggaaatgatgtgcagcactttaaggtgcttcgagacggagctggcaagtacttcctt
tgggtggtaaagttcaattctctaaatgaattggtagactatcacagatcaacctctgtc
tccagaaatcaacagatattccttcgggacattgagcaggtgcctcagcaacccacatac
gttcaggctctttttgatttcgatcctcaggaggaaggtgagctgggcttccgtcgtgga
gactttatccaggtccttgacaattctgaccccaactggtggaagggagcctgccatgga
caaactggcatgtttccacgcaactatgtgaccccggtgaaccggaacatctag

DBGET integrated database retrieval system