KEGG   Anolis carolinensis (green anole): 100564405Help
Entry
100564405         CDS       T01608                                 

Gene name
tufm
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:acs03012]
    100564405 (tufm)
   03029 Mitochondrial biogenesis [BR:acs03029]
    100564405 (tufm)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100564405 (tufm)
Translation factors [BR:acs03012]
 Eukaryotic Type
  Elongation factors
   100564405 (tufm)
 Prokaryotic Type
   100564405 (tufm)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100564405 (tufm)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100564405 (tufm)
  Exosomal proteins of breast cancer cells
   100564405 (tufm)
  Exosomal proteins of colorectal cancer cells
   100564405 (tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 100564405
NCBI-ProteinID: XP_003225287
Ensembl: ENSACAG00000005399
UniProt: H9GA61
LinkDB All DBs
Position
Un
AA seq 460 aa AA seqDB search
MATRALLVARGGLGGVIGLRGCHSRLLQGVLTKLALPCTAFNGQTFLVRNFAVEAKKVYV
RDKPHVNVGTIGHVDHGKTTLTAAITKILSEAGAAKFKKYEEIDNAPEEKTRGITINASH
VEYSTPNRHYAHTDCPGHADYVKNMITGTAPLDGCILVVAATDGQMPQTREHLLLAKQIG
VKHVVVYINKADAVDDSEMLDLVELEIRELLTEFGYDGENAPVIVGSALCALEQRNPELG
LNSIMKLLDAVDTYIPLPQRELDKPFLLPIEHVYSIPGRGTVVTGTLERGIVKKGDECEF
LGHNRNVRSVVTGVEMFHKQLERAEAGDNLGALVRGLKREDIRRGMVMCKPGSIQPHQKV
EAQVYVLNKDEGGRHKPFVSNFTPVMFSLTWDMACRIELPAGKEMVMPGEDTSLLLILRQ
PMVLEEGQRFTLRDGSKTIGTGVVTKTLPLAPGDEEKWVN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccgcgcgctgctggtggcccgtggagggctgggcggcgtgattggcttgcgt
ggttgccactcccgtctcctgcaaggtgttttaaccaagctagctctgccttgcacagct
ttcaatggacaaactttccttgtgcgaaatttcgcagtcgaagcaaagaaagtatacgta
cgggacaaacctcatgtcaatgttgggaccattgggcacgtggaccacggcaagacgaca
ttaacagcagctataactaaaattctgtctgaggctggagctgctaagtttaaaaaatac
gaagaaattgataatgcaccagaagagaaaacacgtggcatcacaatcaatgcctcccat
gtggagtattcaacacccaaccgtcattatgcccatactgattgccctgggcatgctgac
tatgtcaagaacatgatcacagggacagcaccactggatggctgtattcttgtagtggca
gcaacagatggccagatgccacagacgagggagcaccttctgcttgctaaacagatagga
gtgaagcatgtggtggtgtacatcaacaaagcggatgcagtcgatgattcagagatgttg
gacttggtagaattggagatccgtgagctgctcacagaatttggctatgatggggagaat
gctcctgttattgtggggtctgctctgtgtgctttggagcaacggaatcctgaactgggc
ttgaattccatcatgaagctactggatgcagtcgatacatacatccctctgccgcaacgt
gagcttgacaagcctttcctgcttcccatagagcatgtttactccataccagggcgaggc
actgtggtcacaggtactcttgaacgtggcattgtcaaaaaaggagatgaatgtgaattt
ctaggacataatcggaatgtgcgttctgtggtgactggtgttgagatgttccacaaacaa
ctggagcgggcagaggctggtgacaatttgggtgctttggtgcgaggattaaagcgagag
gatatacggcgtgggatggttatgtgcaagccaggctctattcagccacaccagaaagtt
gaggctcaggtgtatgtcttgaataaagacgaaggtggtcgtcacaaaccttttgtgtct
aacttcacgcctgtcatgttttctctgacgtgggacatggcctgccgtatagaattgcct
gcaggaaaggaaatggtgatgccaggtgaggacacttcccttttgctaatactgcggcag
cccatggtcctggaggagggacagcgattcacactgcgagatggaagcaaaaccattggc
accggcgtggtcacaaaaacgcttccacttgctccaggcgacgaagaaaagtgggtcaat
taa

DBGET integrated database retrieval system