KEGG   Anolis carolinensis (green anole): 100564618Help
Entry
100564618         CDS       T01608                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00051  Fructose and mannose metabolism
acs00052  Galactose metabolism
acs00500  Starch and sucrose metabolism
acs00520  Amino sugar and nucleotide sugar metabolism
acs00524  Neomycin, kanamycin and gentamicin biosynthesis
acs01100  Metabolic pathways
acs01200  Carbon metabolism
acs04910  Insulin signaling pathway
Module
acs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
acs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100564618
   00051 Fructose and mannose metabolism
    100564618
   00052 Galactose metabolism
    100564618
   00500 Starch and sucrose metabolism
    100564618
   00520 Amino sugar and nucleotide sugar metabolism
    100564618
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100564618
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100564618
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100564618
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100564618
Membrane trafficking [BR:acs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100564618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100564618
NCBI-ProteinID: XP_008120437
Ensembl: ENSACAG00000005606
LinkDB All DBs
Position
Un
AA seq 920 aa AA seqDB search
MAEGHQEDGTEGDILGQVDKYLYHMRLSDETLQEISDRFGKDMEKGLGADTNPTASVKML
PTFVRSTPDGTEEGEFLSLDLGGTNFRVLRVKVADNGSKKVEMENQIYAIPEDLMRGSGA
QLFDHIAECLASFMEQLQIKEKKLPLGFTFSFPCYQTKLDESILVNWTKGFKSSGVEGRD
VVSLLRKAIRKRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEVGLIVGTGSNACYMEDMRH
IDLVEGDEGRMCINMEWGAFGDDGSLSDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGE
LVRIILVKMAKEELVFDGRLTPDLLTRGHFETRFVSAIEKEQEGLNKAREILTRLGLDPT
PEDCVATQRICQVVSTRSANLCGAALCAVLRRIKENKGVDRLRTTVGVDGTVYKKHPHFA
RRLQKVVRRLLPDCEVRFIRSEDGSGKGAAMVTAVAYRLAAQQKVRQEILDPLRLSHEQL
MEVKRRMRQEMERGLALDSHPEATVKMLPSFVCSTPDGTEKGDFLALDLGGTNFRVLLVR
IRTGIRRSVEMHNKIYAIPQEIMQGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSF
PCDQTSLDKGILVEWTKGFSATGCEGNDVAEMLREAMRRREEFDLDVVAVVNDTVGTMMA
CAYEDPLCEVGLIVGTGSNACYMEEMKNVELVEGDEGRMCINMEWGAFGDNGCLDDFRTE
FDVAVDDNSLYPGKQRYEKMISGKYLGEIVRNILINFTKRGLLFHKRGLLFRGRISERLK
TQDIFETKFLSQIESDRLALLQVRSILQHLGLESTCDDSIIVKEVCAVVARRAAQLCGAG
MAAVVEKIRENRGLDFFRVTVGVDGTLYKLHPHFSAVMHETVRKLAPKCEVSFLQSEDGS
GKGAALITAVACRIREAGQH
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggggcaccaggaggatgggacggagggggacatcctgggacaggtggacaag
tatctctatcacatgcgtctttcggacgagacgctgcaggagatttcggaccggtttggg
aaggacatggagaagggcctgggggccgacaccaaccccactgcctccgtgaagatgctg
cccaccttcgtgaggtccacccccgacgggacagaggaaggggaattcctgtccctggat
ctgggaggaaccaacttccgggtcttgagggtcaaggtggccgacaatgggagcaagaag
gtcgagatggagaaccagatctatgccattccggaggacctcatgcgcggaagcggagcg
cagctctttgaccacattgcggagtgcctggccagcttcatggagcagctgcagatcaag
gagaagaagctcccgctgggcttcaccttctccttcccttgctaccagaccaaactggac
gagagcatccttgtgaactggaccaaagggttcaagtccagtggcgtggaaggccgggat
gtggtctccctcctgcggaaagccatccggaagcgcggggactttgacatcgatattgtt
gccgtggtgaatgatacggttgggacgatgatgacctgcgggtacgacgaccacaactgc
gaagtggggctcattgttggcaccggttccaacgcttgctacatggaggacatgcgccac
atcgacttggtggaaggggacgaggggcgcatgtgcatcaacatggagtggggcgccttc
ggggacgatgggtcgctcagcgacatccggaccgagttcgaccgggagatcgacatgggg
tccctgaacccaggaaaacaattgtttgagaagatgatcagtgggatgtacatgggggag
ctggtgcggatcatcctggtcaagatggccaaagaggagctggtcttcgacgggaggctc
accccggacctgctgaccaggggccactttgagacccgattcgtctccgccattgagaag
gagcaggagggcctgaacaaggcccgggagatcctgacccggctgggcctggaccccacc
cccgaggactgcgtggccacgcagcgcatctgccaggtggtctccacgcgctccgccaac
ctctgcggggccgccctctgcgccgtcctgcgccgcatcaaggagaacaagggggtcgac
cggctgcggaccaccgtgggggtggacggcactgtctacaagaagcacccccacttcgcc
cggcggctgcagaaggtggtgcggcggctgctcccggactgcgaggtgcgcttcatccgc
tcggaggacgggagcgggaagggggcggccatggtgacggcggtggcctaccggctggcg
gcacagcagaaggtccggcaggagatcctggacccgctgcgcctgagccacgagcagctg
atggaggtcaagcggcgcatgcggcaggagatggagcgcggcctggccctggacagccac
cccgaggccaccgtcaagatgctgccctccttcgtctgctccaccccggacggcaccgaa
aagggagacttcctggccctggacctcgggggcaccaacttccgggtgctgctggtgagg
atccggaccgggatccgtcggagcgtggagatgcacaacaagatctacgccattccgcag
gagatcatgcaagggaccggggaggagctctttgaccacattgtgcaatgcatcgcggac
ttcctggagtacatgggcatgaagggcgtctccctcccgctgggcttcaccttctccttc
ccctgcgaccagaccagtctcgacaaggggatcctggtggaatggaccaaaggcttcagc
gcaacgggatgcgaagggaacgacgtggccgagatgctcagggaagccatgcgcaggaga
gaggagtttgacctcgacgtggtggcggtggtcaacgacacggtgggcaccatgatggcc
tgcgcctacgaagaccctctgtgcgaagtggggctgattgtcggcaccggttccaacgct
tgctacatggaggagatgaagaacgtggagctggtggagggcgacgaggggcgcatgtgc
atcaacatggagtggggcgccttcggggacaacggctgcctggacgacttccggacggag
ttcgacgtggccgttgacgacaactctttgtacccggggaagcagaggtatgagaaaatg
atcagcggcaagtacttgggtgagatcgtccgcaacatcctgatcaatttcaccaagcgc
gggctgctcttccacaagcgcgggctgctcttccgcgggcggatctccgagcgcctgaag
acccaggacatcttcgagaccaagttcctgtctcagatcgagagtgaccggctggccttg
ctgcaggtgcgctccatcctgcagcacctgggcctggagagcacctgcgacgacagcatc
atcgtgaaggaggtgtgcgccgtggtggcccggagggcggcccagctgtgcggagcgggg
atggcggccgtggtggagaagatccgggagaaccgcggcctggacttcttcagggtcacc
gtcggggtggacggcaccctctacaagctgcacccgcacttctcggccgtcatgcacgaa
acggtgcgcaagctggctccgaagtgcgaggtgagcttcctccagtccgaagacggcagc
ggcaaaggggcggccctcatcacggccgtggcctgccgcatccgcgaggccggccagcac
tag

DBGET integrated database retrieval system