KEGG   Anolis carolinensis (green anole): 100564808
Entry
100564808         CDS       T01608                                 

Gene name
chek1
Definition
(RefSeq) checkpoint kinase 1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100564808 (chek1)
   04115 p53 signaling pathway
    100564808 (chek1)
   04218 Cellular senescence
    100564808 (chek1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100564808 (chek1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acs03400]
    100564808 (chek1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100564808 (chek1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100564808 (chek1)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100564808 (chek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH Baculo_VP1054
Other DBs
NCBI-GeneID: 100564808
NCBI-ProteinID: XP_003225759
Ensembl: ENSACAG00000000155
UniProt: H9G3B5
LinkDB
Position
Un
AA seq 475 aa
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRRTEEAVAVKIVDMKRAIECPEQIKKEICINK
MLSHENIVKFYGHRREGTIQYLFLEYCSGGELFDRIEPDIGMPEAEAQRFFHQLIGGVVY
LHSLGVTHRDIKPENLLLDERDNLKISDFGLATVFKYNGRERLLNKICGTLPYVAPEVLK
RKEFHAEPVDVWSCGIVLTAMLAGELPWDQPTETCQEYCDWKEQKSYLAPWKKIDSLPLA
LLIKILTENPASRLTIADIKKDKWYTKLLQKGIKRSRISTEPSDSPGVFSKHIRSDTDFS
PVKDTHSEERRTYSNSQPEPGTGLSFWDNSPANIDKLVQGISFSQPACPEHMLLNSQLLG
TPGSSQNPWQRLVKRMTRFFLKLDAEQSYEILKEVCDKMGYIWKKGCTNEVTISTTDRRN
NKLIFKANLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLVDVVSAQKLWLPAT
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcagtgccttttgtagaagattgggacttggtgcaaacccttggagaaggtgcttat
ggagaagttcaactggcagtgaacagacgcactgaagaagcagttgcagtcaaaattgtt
gacatgaagcgtgccattgaatgtccagaacagattaagaaggagatctgcatcaacaaa
atgttgagtcatgagaacatagtgaagttctatggccatcggcgagaaggcactattcag
tatcttttccttgaatactgcagcggaggggagctgtttgaccgaatagagcctgatata
gggatgcctgaagcagaagcacagaggttttttcaccagcttataggtggtgtggtctac
ctacacagcttaggagtaacacatcgggatattaagcctgagaatctgttgctggatgaa
agagataatctcaaaatatccgactttggcctagcaactgtgtttaaatacaatggacgt
gagcgtttgttgaacaagatctgtggcacgttgccatatgttgcacccgaggtccttaaa
agaaaagaattccatgcagagccagttgatgtttggtcttgtggaatagtactcactgct
atgttggcaggagaattaccatgggatcaacctactgaaacttgtcaagaatattgtgac
tggaaagaacagaaatcatatcttgcaccatggaagaagattgattcattaccactggct
ttgcttatcaaaatattaactgagaacccagcatccagactgaccatagcagacattaaa
aaagacaagtggtacaccaaacttttacagaaaggcataaaacggtctcggatctccaca
gaaccctctgattctccaggagttttttctaagcacattcgatcagatactgacttctct
ccagtgaaagacacacacagtgaggaaagaaggacctattccaattctcagccagaacct
ggcactggcctatccttttgggacaacagtcctgccaatattgacaagctagtgcaaggc
atcagcttctcccagccagcctgcccggaacacatgctgctgaacagccaactattgggc
actccaggctcctctcagaatccatggcagcgcttggtgaagagaatgacccggttcttt
ttgaagttggatgcggagcagtcgtatgagatcctgaaggaggtttgcgataagatgggc
tacatctggaagaagggctgcacaaacgaggttaccatatcaacaaccgatagaagaaac
aacaaactgattttcaaggcaaacttagtagaaatggatgagaaaattcttgtggacttc
cgtctgtctaagggcgatggtttggagttcaagaggcatttcctgaagatcaaggggaaa
ctggtcgacgttgtcagtgcgcagaagttgtggctcccagccacatga

DBGET integrated database retrieval system