KEGG   Anolis carolinensis (green anole): 100564886
Entry
100564886         CDS       T01608                                 

Gene name
bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04140  Autophagy - animal
acs04141  Protein processing in endoplasmic reticulum
acs04210  Apoptosis
acs04217  Necroptosis
acs04261  Adrenergic signaling in cardiomyocytes
acs04340  Hedgehog signaling pathway
acs04510  Focal adhesion
acs04621  NOD-like receptor signaling pathway
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100564886 (bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100564886 (bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100564886 (bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    100564886 (bcl2)
   04217 Necroptosis
    100564886 (bcl2)
   04115 p53 signaling pathway
    100564886 (bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100564886 (bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100564886 (bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100564886 (bcl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100564886 (bcl2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100564886 (bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100564886 (bcl2)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100564886 (bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100564886
NCBI-ProteinID: XP_008122499
LinkDB
Position
Un
AA seq 245 aa
MAHPGIRGYDNREIVLRYIHYKLSQKGYDWVASGDRGNLAAAAAAAAATPSAPTVSASLS
PELLNSDPVSTNAPREEPDPVPQVVHTTLRQAGDEFSRRYRRDFAQMSGQLHLTPSTARS
RFVAVVEELFQDGVNWGRIVAFFEFGGMLCVESVSREMSPLVDNIATWMTEYLNQYLRNW
IQENGGWVCGSLSLSFSVSRSYITETSIPVSQMACVTSGSQCGVTCKVVPRAFCLFRTKG
DNQLL
NT seq 738 nt   +upstreamnt  +downstreamnt
atggctcatcctgggataagaggttacgacaacagggaaatcgtgctgaggtacatccat
tacaagctgtcgcagaaaggatatgactgggttgccagtggagacagaggaaaccttgct
gctgctgctgctgctgctgctgctactcctagtgctccaactgtgtcagcatctctttcc
ccagagcttctcaattctgatcctgtgagtaccaatgcccccagggaagaacctgacccg
gtgccacaggttgtccatacaacattacgccaagccggagatgagttctcccgacgctat
cggagggactttgctcaaatgtctggccagctgcatttgacccccagcactgccagaagt
cgttttgtggccgtggtggaagagctcttccaggacggtgtgaactgggggaggattgtg
gcgttctttgaatttggtggcatgctgtgcgtggagagtgtcagccgggagatgtccccc
cttgtggacaatattgctacgtggatgactgagtatctgaaccagtacctgcgcaactgg
atccaggagaacggaggctgggtatgtggctcattgtctttgtctttttctgtttcaagg
tcatacatcactgaaacatccattccggtgtcacaaatggcttgtgtgaccagtggttcc
cagtgcggtgtcacttgtaaagttgttccaagggcattttgcttattccgaacaaaaggt
gacaaccagttattatag

DBGET integrated database retrieval system