KEGG   Anolis carolinensis (green anole): 100564911Help
Entry
100564911         CDS       T01608                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00500  Starch and sucrose metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100564911
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100564911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100564911
NCBI-ProteinID: XP_003220126
Ensembl: ENSACAG00000001468
UniProt: G1K9V7
LinkDB All DBs
Position
4
AA seq 512 aa AA seqDB search
MKIFFLLVAFELCWAQYNPNTKSGRTSIVHLFEWRWADIALECERYLAPNGYGGVQISPP
NENIVITNPWRPWWERYQPISYKLCSRSGSENEFIDMVTRCNNVGVHIYVDAVVNHMCGS
GGGEGTHSTCGSYFNAGTRDFPAVPYSAWDFNDGKCKTYSGEIENYNDAYQVRDCRLVSL
LDLALEKDYVRSTVANFMNRLIDIGVAGFRIDASKHMWPGDMKAFLDKLKNLNTSWFPEG
TKPFIFQEVIDLGGEAISASEYFGNGRVTEFKYGAKLGTVIRRWNGEKMAYLKNWGEGWG
FMSSDRALVFVDNHDNQRGHGAGGASILTFWDPRLYKMAIGFMLAHPYGFTRIMSSFRWS
RNFVDGKDVNDWMGPPSNSDGSTKSVTINPDTTCGNGWVCEHRWRQIRNMAIFRNVVDGQ
AFTNWWDNNSNQVAFGRGNKGFIVFNNDDWNLSETLQTGLPAGTYCDIISGEKEGNSCTG
IRIEVQGDGKAYFQISNTAEDPFVAIHVNAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttttttcctcctagtggcttttgagctttgttgggctcagtacaacccaaat
acaaagtctggaaggacctctattgtccacctctttgaatggcgttgggctgacattgct
ctggagtgtgagcgctatctggcacctaatggatatggtggagtgcagatctcccctcca
aatgaaaatattgtcattacaaatccatggaggccatggtgggaaagatatcagcccatc
agctacaaactatgttcacgatctgggagtgaaaatgaattcatagacatggtcaccaga
tgcaacaatgttggagtacatatctatgttgatgctgtagtcaaccacatgtgtggatct
ggaggtggagaaggcacccattctacttgtggaagctattttaatgccggtacccgtgac
tttcctgcagtcccttattcagcatgggacttcaatgatgggaaatgcaaaacatatagt
ggagagattgaaaattacaatgatgcttaccaggtccgtgattgtcgccttgttagtctt
cttgaccttgctctggagaaggactatgtgcgctcaacagttgctaactttatgaatcgc
ctgattgacattggagtagcaggatttcggattgacgcttccaaacatatgtggcctggg
gacatgaaagcatttttagacaagctaaagaatttgaacacaagttggtttcctgaagga
acaaagccattcatctttcaagaggtgattgatttgggtggagaggccatctcagccagt
gaatacttcggaaatggccgggtaacagaattcaaatatggtgcaaaattagggacagtc
attcgcaggtggaatggagaaaagatggcttatctaaagaactggggtgaaggctggggt
ttcatgtcttctgacagagctctggtttttgtggataatcatgataaccagagaggacat
ggtgctggcggagcttccattttgactttttgggatcctagactctacaaaatggcaatt
ggtttcatgcttgctcacccctatggttttactcgaatcatgtcaagtttccgttggtca
aggaattttgtggatggaaaggatgtgaatgactggatgggacctccaagcaattctgat
ggctcaactaagtcagtcaccattaatccagatacaacctgtggcaatgggtgggtctgt
gaacatcgatggcgtcaaataaggaatatggctattttccgcaatgttgttgatggacag
gcttttaccaattggtgggacaataatagtaatcaagtggcatttggtcgtggcaacaaa
ggattcattgtctttaataatgacgactggaacttgtctgaaacactgcaaaccggtctt
cctgcaggcacatattgtgatataatttctggtgaaaaagaggggaacagctgcactgga
atcagaattgaagtccaaggtgatggcaaagcttattttcagatcagcaacactgctgaa
gacccatttgttgcaattcatgttaatgcaaaattataa

DBGET integrated database retrieval system