KEGG   Anolis carolinensis (green anole): 100564983Help
Entry
100564983         CDS       T01608                                 

Gene name
myh7b
Definition
(RefSeq) myosin heavy chain 7B
  KO
K17751  myosin heavy chain 6/7
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04260  Cardiac muscle contraction
acs04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acs00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100564983 (myh7b)
   04261 Adrenergic signaling in cardiomyocytes
    100564983 (myh7b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acs04812]
    100564983 (myh7b)
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100564983 (myh7b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Filament Sec2p DUF745 HutP AAA_22 AAA_16
Motif
Other DBs
NCBI-GeneID: 100564983
NCBI-ProteinID: XP_003220529
Ensembl: ENSACAG00000007497
UniProt: L7MZS4
LinkDB All DBs
Position
4
AA seq 1944 aa AA seqDB search
MSAGHMMDMTEFGEAAEYLRKSYEELMKYHTMPFDGKKRAWIPDEKEAYIEIEIKESSGG
KVTVETKDRKSLVVKEDDIQQMNPPKFDMIEDMAMLTHLNEASVLHNLKRRYGKWMIYTY
SGLFCVTINPYKWLPVYTPPVVAAYKGKRRSEVPPHIYSIADNAYNDMLRNRENQSMLIT
GESGAGKTVNTKRVIQYFAIVAALGDSPGKKGQAPATKTGGTLEDQIIEANPAMEAFGNA
KTLRNDNSSRFGKFIRIHFGPSGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILSGK
KPELQDMLLLSSNPYDYHFCSQGVTTVDNLDDGEELLATDHAMDILGFSPEEKYGCYKIV
GAIMHFGNMKFKQKQREEQAETEGTESADKASYLMGISSGDLIKGLLHPRVKVGNEYVTK
NQTVDQVVYAVGALAKATYDRMFKWLVVRINKTLDTKLARQFFIGVLDIAGFEIFEYNSF
EQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGLDLQACIDLIEKPLGILSI
LEEECMFPKASDTSFKAKLYDNHIGKSPNFQKPRPDKKRKYEAHFELVHYAGVVPYNIIG
WLDKNKDPLNETVVAIFQKSQNKLLANLYENYVSSSSDEGMKTGKEKRKKAASFQTVSQL
HKENLNKLMTNLRATQPHFVRCIIPNETKTPGAMDPFLVLHQLRCNGVLEGIRICRKGFP
NRILYADFRQRYRILNPAAIPDDKFMDSRKAAEKLLTSLELDSSQYKFGHTKVFFKAGLL
GLLEEMRDERLAKIITLLQARMRGRIMRIEYGWIIGRRDALYTIQWNLRAFNVVKNWSWM
KLFFKIKPLLKSAQTEKEMAILKEEMQKLKEALEKSEAKRKELEEKQVSIIQEKNDLSLQ
LQAEQDNLADAEERCDLLIKTKIQLEAKVKELMERLEDEEEMNSDLTSKKRKLEDECAEL
KKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDEVIAKLTKEKKALQEAHQQALDDL
QAEEDKVNTLTKAKVKLEQQVDDLESALEQEKKIRMDLERAKRKLEGDLKLTQESVMDLE
NDKQQLEEKLKKKDFEMNQLNSRIEDEQILATQLQKKIKELQARIEELEEELEAERAARA
KVEKQRAEVAHELEELSERLEEAGGATACQIELNKKREAEFLKLRRDLEEATLQHESTAA
TLRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEVDDLSSNIDYLTKNKANAEKLCR
TYEDQLSEAKSKVDELQRQLAEVSTQRGRLQTESGELSRLLEEKESLINQLSRGKTSFTQ
TIEELKRQLEEETKSKNALAHALQASRHDCDLLREQYEEEVEAKGELQRSLSKANAEVAQ
WRTKYETDAIQRTEELEEAKKKLAIRLQEAEEAVESAHAKCSSLEKTKHRLQTEIEDLSI
DLERANSAAAALDKKQRNFDRIISEWKQKYEETQSELESSQKESRSLSTELFKLKNAYEE
SLENLETLKRENKNLQEEITDLTDQISMSGKTIHELEKLKKGLESEKNDIQAALEEAEGA
LEHEESKTLRIQLELSQIKADVDRKLAEKDEEFENLRRNHQRAMDSMQASLDAEAKARNE
AIRLRKKMEGDLNEMEIQLSHANRQAAESQKLVRQLQAQMKDLQIELDDTLRYNDDLKEQ
AAALERRNNLLMAEVEELRAALEQAERGRKLAEQELLEATERVNLLHSQNTGLINQKKKM
EADISQLSTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTI
KDLQMRLDEAEQIALKGGKKQIQKLEARVRELEGELDVEQKKNAETQKGIRKYERRIKEL
TYQTEEDRKNLARMQELIDKLQSKVKSYKRQFEEAEQQANSNLVKYRKVQHELDDAEERA
DIAETQVNKLRVRTREVVTLKHEE
NT seq 5835 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggtcatatgatggacatgacggagtttggggaggctgctgagtacctccgg
aaaagttatgaggagctgatgaaatatcacactatgccctttgatggaaagaagagggcc
tggatcccagatgaaaaggaagcctatattgaaattgaaatcaaagaatcctctggtggc
aaagtcactgtggaaaccaaagatagaaagagccttgttgttaaagaggatgacattcaa
caaatgaatcctcccaaatttgatatgattgaggacatggccatgttaacccacctcaac
gaggcttcagtgctgcataacctgaaacggcgttatggcaaatggatgatctatacctat
tcgggcttgttctgtgtcaccataaacccatataaatggcttccagtttatactcctcct
gttgtcgctgcttataagggcaaacggagatctgaggtcccacctcacatttactccatt
gccgataatgcctacaatgacatgttgcgcaatcgtgagaaccagtctatgctcatcacc
ggagaatctggtgctggtaagactgtaaacaccaagcgggtcattcagtactttgccatt
gtcgcagccctgggtgactctccagggaagaaaggacaagctcctgccactaaaactggg
ggtacccttgaagatcaaatcattgaggctaacccagcaatggaagcttttgggaacgcc
aaaactctgagaaatgacaactcctcacggtttggcaagttcatccgcattcattttggt
ccatcaggaaagctggcttctgctgacattgacatctacttgttggaaaaatcaagagtg
attttccagcagccaggagagaggagctaccacatctactatcaaatcctttctggaaag
aagccagagctccaagatatgcttctgctctcttccaatccatatgactatcacttctgc
tctcaaggagtaacaactgtggacaacttggatgatggagaagaactcttggctacagat
catgctatggacatcctaggcttcagccccgaggagaaatatggctgctataaaatagta
ggagccatcatgcactttggcaacatgaagttcaagcagaaacaacgtgaggaacaagca
gaaactgaaggcactgaaagtgctgataaagcttcttacctcatgggaatcagctcaggg
gatctaatcaaggggctgcttcatccaagggtgaaagttggaaatgaatatgtaaccaaa
aatcagactgttgatcaggtagtctatgcagtgggagctttagccaaagctacctacgat
cgcatgttcaagtggttagttgttcgtatcaacaaaaccctggacactaaactagccagg
cagttcttcattggagttctagatattgctggctttgagatctttgagtataacagtttt
gagcaattatgcatcaacttcacaaatgaaaagctgcaacagtttttcaaccatcacatg
tttgttctggaacaagaagaatataagaaagaagggattgaatgggtcttcattgatttt
gggctggacctgcaggcttgtattgatctgattgaaaagccattaggaatcctctcaatt
ttggaagaagagtgtatgtttcccaaagcctctgatacatcattcaaggccaaactatat
gataaccacattgggaaatcacccaatttccaaaagccccgaccagataagaagcgcaag
tatgaagcccactttgagttggtgcactatgcaggagtggttccctacaacattattggc
tggctagataagaataaagaccctttgaatgagacagtggtagccatcttccaaaaatca
caaaacaagctactggctaatttatatgaaaactatgtgagctcttcatcagatgaagga
atgaagacaggaaaagagaaacgtaagaaggcagcttcattccaaacagtgtcccagctg
cataaggaaaacctgaacaaactgatgaccaatttgcgtgccacccagccccattttgtc
cgttgcatcatccccaatgaaacaaagactccaggtgccatggacccctttttagttctt
catcagttgcgatgtaatggtgtgttggaaggcatccgaatctgtaggaaagggtttcca
aacaggattctctatgctgacttcaggcaacgctaccgtatcctgaaccctgctgccatt
cctgatgacaagtttatggatagcaggaaggccgcagagaaactgctgacttccttagag
cttgactcttctcagtataaatttggacacactaaggtgtttttcaaagccggcttactg
ggtcttttggaggagatgcgagatgaacgtctggccaagattattaccttgctgcaggct
aggatgcgagggcgtattatgagaatcgagtatggatggattattggcagaagggatgcc
ctctacaccatccagtggaatcttcgtgcattcaatgttgtaaagaactggtcctggatg
aaacttttcttcaagatcaagcctctcctaaagtcagctcagacagaaaaagaaatggca
atcctcaaagaggagatgcagaagttgaaggaggccctggagaagtcagaggctaaaagg
aaagagctggaagagaaacaagtcagcattattcaggagaagaatgacctgtcactgcag
cttcaagcagaacaagacaacttagcagatgccgaagagcgctgtgatctcctgatcaaa
accaagatccagctggaagctaaggtgaaagaactaatggagcgtcttgaggatgaggaa
gagatgaactcagacttgacctctaagaagcgaaagctggaggatgaatgtgctgagcta
aagaaggacattgatgacttggaaatcactttggccaaggtggaaaaggaaaagcatgcc
acagaaaacaaggttaaaaacctaattgaagaaatggctgctttggatgaggtcattgct
aagctgaccaaggaaaagaaggccctgcaggaagcccatcagcaagctctggatgacctt
caggcagaagaggacaaagtcaatactctgaccaaggctaaagtcaagctggagcagcaa
gtggatgatcttgaaagtgccttagagcaagagaagaagatacgaatggatttggaaagg
gcaaagcgcaagctagaaggtgacttgaagctgactcaggagtctgtgatggatctggag
aatgacaagcagcagctagaggagaaactcaaaaagaaagactttgaaatgaatcagtta
aattcaaggattgaagatgagcaaattcttgcaactcagctgcagaagaaaattaaagaa
ctacaggcccgtattgaagaactggaagaggagcttgaagcagaacgagctgcaagagcc
aaggtggagaagcagcgggcagaggtggcccatgagctggaggaattgagcgaacggctg
gaggaggcgggcggtgccactgcttgtcagatagaactgaacaagaagcgggaagcagaa
ttcttaaagctgcggcgagatctggaagaggccacactgcagcacgaatcaactgctgca
acccttcgcaaaaagcatgcagactctgtggctgaactgggggaacagattgacaacctc
cagcgtgtcaaacagaagctggagaaggagaagagcgaactgaagatggaagtggatgat
ctgtcttccaacattgactacctcaccaagaataaggcaaatgctgaaaaactctgtcga
acatacgaagatcagctgagtgaagctaaatcaaaggtggatgagctccaacgccagctg
gctgaagtgagcacccagcgtgggaggctgcagactgaaagtggagaactgagccggctg
cttgaagagaaggagtctcttataaaccagctgagtcgaggcaagacttccttcacacag
acaattgaagaactcaagagacagctagaagaagagaccaagtccaaaaatgcattggct
catgctttgcaagcttctcgtcatgactgtgaccttctgcgggagcagtacgaagaggag
gtagaagcaaaaggggaactccagcgttccttgtccaaagccaatgctgaagtggcccag
tggaggaccaagtatgagacagatgccatccagaggacagaagagctagaggaagccaag
aagaagttggccatccgtctgcaagaggcagaggaagctgtggaatcagcacatgccaag
tgctcctctttggagaagaccaagcaccgtttgcagactgagattgaggacctctcaatt
gacttggagagagctaattcagccgctgctgctttggacaaaaaacagcgcaattttgac
aggatcatttctgagtggaagcagaaatatgaggagacacagtcagagctggagtcttct
caaaaggagtcccgaagcctaagcacagaactattcaagctcaagaatgcctatgaggag
tcactggagaatctagagactctcaaacgggaaaacaagaacttgcaagaggaaattact
gacctgactgatcagattagcatgagtggcaaaaccattcatgagctggagaagctgaag
aaaggcctggagagtgagaagaatgacatccaggctgccctggaggaggctgagggagcc
ctggagcatgaggagagcaagactctacgcatacagctggaattgtcccaaattaaagca
gacgttgataggaaactggctgaaaaggatgaagagtttgagaacttgaggcgtaaccac
cagagagccatggactccatgcaggcttctttggatgcagaagccaaagccagaaacgag
gccattaggttgcgaaagaagatggagggagacctgaatgagatggagatccagttgagc
catgcaaatcgccaggctgctgagtctcagaaactggtgcggcagctccaggcccaaatg
aaggacttgcagatcgaattggatgacaccttgcgctataacgatgacctgaaggagcag
gcagctgctctggaaaggcgcaacaacctgttgatggctgaggtggaggaactgcgtgcg
gcactggaacaggctgagcgcggaaggaagctggctgagcaggagctcctggaggccacg
gagagagtgaatttgctgcactcccagaacacaggcctgatcaaccagaagaagaagatg
gaggcagacatttctcagctgagcacggaggtagaggaggcagttcaggagtgtcggaat
gcagaagaaaaggccaagaaggccattactgatgcagccatgatggcagaggaactgaaa
aaggagcaggacacgagcgctcaccttgaacggatgaagaagaatatggaacaaaccatc
aaggatctacagatgcgactggatgaagctgaacagattgccctcaaaggaggcaagaag
cagatccagaaactagaggctagggtgagagaattggagggcgagttggatgtagaacag
aagaaaaatgcggaaactcagaagggaattcggaaatatgagcgcagaatcaaagaactg
acttaccagactgaagaggacaggaagaacctggcacggatgcaggagctgattgacaaa
ttgcagagcaaagtcaagagctacaagcgccagtttgaggaggctgagcaacaagccaac
tctaacctggtgaaataccgtaaggtgcaacatgagctggatgatgcagaagagagagct
gatattgcagagacacaagttaacaagctacgggttcgcactagagaagttgtgacactg
aagcatgaagagtaa

DBGET integrated database retrieval system