KEGG   Anolis carolinensis (green anole): 100565024
Entry
100565024         CDS       T01608                                 

Gene name
cdkn1c
Definition
(RefSeq) cyclin dependent kinase inhibitor 1C
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100565024 (cdkn1c)
   04068 FoxO signaling pathway
    100565024 (cdkn1c)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100565024 (cdkn1c)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100565024
NCBI-ProteinID: XP_003214802
LinkDB
Position
1
AA seq 210 aa
MSTARVSSGSPTLERMEARQAEGAPKPSACRSLFGPVDHEQLRREFRGQLRQIREESQRR
WEFDFAAGAPLPPGHQARFQWEEVDAAALPAFYRETLLPGAARRLLRRKSKAPAEGEEEE
QERDEPATQPESDGSAARRAQPRRSGERLLLRDPPQASPGVRQEDEGRPHHRFLRQAEKS
GRGLQQRVGLGADAPEKAPMNEILHYRTPK
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtcgacggcgcgcgtctcgagcgggagcccgaccctggagcggatggaggcgcggcag
gcggagggggcgcccaagccctcggcctgccggagcctcttcggccccgtggaccacgag
cagctccgccgcgagttccggggccagctgcgccagatccgcgaggagagccagcgccgc
tgggagttcgacttcgccgcgggcgcgcccctcccgcccgggcaccaggcgcgcttccag
tgggaagaagtggacgccgccgccctgcccgccttctaccgggagaccctgctgcccggg
gccgcccgccgcctcctccggcgtaagagcaaggcgcccgcggaaggggaagaagaggag
caggagcgggacgagcccgccactcagcccgagagcgacggctccgccgctcggcgcgct
cagccacgaaggagcggagagcggctgctactcagggatcctcctcaagcctctcccggg
gtccgccaagaggacgagggtcgcccacatcaccgatttcttcgccaagcggaaaagagt
ggccgcggactccagcagcgcgttggccttggagcagacgccccggaaaaggctccgatg
aacgagattttgcactataggacaccgaagtga

DBGET integrated database retrieval system