KEGG   Anolis carolinensis (green anole): 100565071
Entry
100565071         CDS       T01608                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100565071 (cdkn1b)
   04068 FoxO signaling pathway
    100565071 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100565071 (cdkn1b)
SSDB
Motif
Pfam: CDI DUF123
Other DBs
NCBI-GeneID: 100565071
NCBI-ProteinID: XP_008119870
Ensembl: ENSACAG00000004348
UniProt: H9G8U5
LinkDB
Position
Un
AA seq 198 aa
MSTARVSSGSPTLERMEARQAEGAPKPSACRSLFGPVDHAELARELRRHRREAEEAARRR
WEFDFLREQPLRGPGARFEWRALRKDALPDFYSRPPRLSRRWGSGAGPGDSPPAAGKWRP
QWRRIRGLSAEEEDGDEEEATQADGEGPPSSRKRPVSDDSCLPNKRANMTEEAVSEGSPS
ASSVEQTPKKSSPRHRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcgacggcgcgcgtctcgagcgggagcccgaccctggagcggatggaggcgcggcag
gcggagggggcgcccaagccctcggcctgccggagcctcttcggccccgtggaccacgcc
gagctggcccgcgagctgcgcaggcaccgccgggaggccgaggaggccgcccgccgccgc
tgggagtttgacttcctccgcgagcagcccctccgagggcccggagcgcgcttcgagtgg
cgcgccctccgcaaggacgccctgcccgacttctacagccgccctccgcggctctcccgg
cggtggggcagcggggcaggccctggggacagccctcccgccgcggggaagtggcggccg
cagtggcgacggatccggggactctccgccgaggaggaggacggggacgaggaggaggcg
acacaggcggatggagaaggcccgcccagttcgaggaagcggcccgtctcggacgattca
tgcctgccaaacaaaagagccaacatgacagaagaggcagtttcagagggctctcccagt
gccagctcagtggaacaaacgcccaagaaatcaagcccaaggcatcgtcaaacgtaa

DBGET integrated database retrieval system