KEGG   Anolis carolinensis (green anole): 100565184
Entry
100565184         CDS       T01608                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04080  Neuroactive ligand-receptor interaction
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100565184 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100565184 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:acs04030]
    100565184 (lpar2)
G protein-coupled receptors [BR:acs04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100565184 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100565184
NCBI-ProteinID: XP_003223254
Ensembl: ENSACAG00000004860
UniProt: H9G9K3
LinkDB
Position
Un
AA seq 344 aa
MTTCYYNESIEFFYNNSGKKLSHIWRPKDILVVALGLTVSIIVLLTNLLVITAIVINKRF
HYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAQLSLKTWFARQCLLDTSLTASVVNLL
AIAVERHQTIFTMQLHSKMSNQRVMILIGCIWITALLLGLIPSYGWHCLCNLSDCSRMAP
LYSRRYLTFWALSNLFIFLIMVVVYTHIFIYVKRKMARMSKHTTFHPRYKDTMINLIKTV
IIILSAFVICWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEINSLINAIVYSYRDNEMR
STFRKILCFACYRNPKYSPASVKSSTTEHRILPQNGHSMMDSTL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaccacgtgctactacaatgagtcaattgagttcttctacaacaacagtggcaagaag
ctgtcccacatatggagacccaaggatattttggtggtcgctcttggcttgacggtcagc
atcattgtgctcctcaccaacttgctggtcatcacggctattgtcatcaacaagcgcttc
cattatcccatctactacctgttggggaacctggcagctgctgacctctttgcaggcatc
gcttacatgttcctgatgttccacactggacccaggacagcgcaactctctctcaagacc
tggtttgccaggcagtgccttttggacaccagcttgacagcctcagtggtcaatctcctg
gccattgcagtggagcggcaccagacaattttcaccatgcagcttcacagcaagatgtcc
aaccagcgggtgatgatcctcattggctgcatctggatcacagccttgctgctgggcctc
atcccttcatacggctggcactgtctctgcaatctgagcgattgctcccggatggctccc
ctctacagccgcagatatttgaccttctgggccctctccaatctcttcatcttcctcatc
atggtggtagtctacactcacatcttcatctatgtgaagaggaaaatggcccggatgtcc
aagcacaccactttccatccccgctataaggacaccatgatcaacctcatcaagacagtc
atcattatcctcagtgcatttgtcatctgctggacccctggacaggtggtactcctattg
gatggccttgactgcaaaagctgcaatgtgctagcagtggaaaagtacttcttgctgctg
gcggaaatcaattcgcttattaatgctattgtctactcctaccgggacaatgagatgcgc
agcacctttcggaagatcctttgctttgcctgctataggaatccaaagtactcaccagct
tcagtcaagtccagcaccacagagcataggatattgcctcagaatggacattcgatgatg
gattccaccctctaa

DBGET integrated database retrieval system