KEGG   Anolis carolinensis (green anole): 100565216Help
Entry
100565216         CDS       T01608                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acs01002]
    100565216 (tmprss9)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100565216 (tmprss9)
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100565216 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 100565216
NCBI-ProteinID: XP_008123899
LinkDB All DBs
Position
Un
AA seq 955 aa AA seqDB search
METAVVKAAGEGQPRKRRWARVAVGTVLASALLAAATAALLACLARPGHGVPTAATIAGP
GSGFSVSEMALKSGRCPGKASFSCRSGQCVPWQNSECDGRKDCLDGSDEDGCDCGGRPAL
GASQQRIVGGSQASRGEFPWQVSLRENGEHFCGAAVLGPTWLVSAAHCFNEFQDPGTWTA
HGGSVWLSGGGKGEEGSQAPVGRILRHPSYDADSADYDLALLQLSAPLGPSRFVQPVCLP
AAGHAFPAGRKCLISGWGYLREDFLVKPELLQKATVELLDQALCDGLYSNALTDRMLCAG
YLEGKVDSCQGDSGGPLVCPEPSGRFFLAGIVSWGIGCAEDRRPGVYTRITRLRDWIRDT
MDSASATSVPPSLPSTVASSSTWDPPSTTSGRPTDTTPLPPNECGRRPGFSKPQRVVGGT
AALHGEVPWQVSLKEEGLRHFCGAAVIAPRWLLSAAHCFNQTKPGRVTAFAGSTLLSVSE
SGSVKAGIRRVLPHPSFRPGRPDFDVALVELLRPLPFGASVQPVCLPPAGPKFPLGRKCF
VSGWGSLRDGDAPRPETLQLASVRIVEQAACSALYGFSLTEQIICAGFLEGKAGACQGDS
GGPLACEEAPGVFSLAGLVSWGVGCTPAKRPRVYARVSRFTGWILETVAAPVGPSSPPKK
GRTTTAVAVAHSSLTSTSGQSSTWPDSTSTRLRTTGLPEVTPMPECGRSPSRWLGRIVGG
SGARRGEWPWQASLQLRRGKRAEHKCGAVLVAPQWLLSAAHCFDLHGDPSSWLAVLGTPF
LEEADGEAETRGVSHLLRHPFYNGVTLDYDLALLRLDRPLRPSPAVRPVCLPGRGPPPPP
GAPCVITGWGSTHEGGPMSRRLQQARVAVVAEAECRRFYPVQISSRMLCAGSPRGAVDSC
SGDAGGPLACREPSSSSWVLAGVTSWGYGCARPAFPGVYASVAPARGWIRQHLRP
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgcggtggtcaaggcggccggagaggggcaaccccgcaagcgccgatgggcc
cgggtggccgtggggacggtcctggctagtgccctcctggccgcagccaccgccgccctc
ctggcctgcctggcgcggcctggccacggggtccccaccgctgccaccattgcaggccca
ggaagcggcttctctgtctccgaaatggccctgaagtccggacgatgtccgggcaaggcc
tccttctcctgccgcagcggccagtgcgtcccgtggcagaactccgagtgcgacgggcgc
aaggactgcctggacggctccgacgaggacggctgcgattgcggagggcggccagccctg
ggtgcgtcgcagcagcgcatcgtggggggctcgcaggcctcgcggggggagttcccgtgg
caggtcagcctccgggagaacggggagcacttctgcggggccgccgtcctgggccccacc
tggctggtctcggccgcgcactgcttcaacgagttccaggatcccgggacgtggacggcg
cacggcgggagcgtctggttgagcggcggcggcaaaggagaggagggttcccaggcgccc
gtgggtcgcatcctgcgccacccctcctacgacgccgactccgccgactatgacctggcg
ctgctgcagctctcggcccccctcggcccctcccgcttcgtccagcccgtctgcctcccg
gccgccggacacgccttccccgccggcaggaagtgcctcatctccggctggggatacctc
cgggaggacttcctggtgaagccggagctgctgcaaaaggccacggtggagctgctggac
caggcgctgtgcgacggcctctacagcaacgccttgaccgaccggatgctctgcgcggga
tacttggagggcaaggtggactcctgccagggggactccggaggccccttggtctgtccg
gagccttccgggcgcttcttcctggccggcatcgtcagctggggcatcggctgcgcggag
gacaggcgcccgggggtctacacgcgcatcaccaggctccgggactggatccgggacacg
atggactccgcctccgccacttccgtgcccccttctctcccgtcgacggttgcatcctcc
tcaacatgggaccccccctccaccacgtccgggcggccgacggacacaacccccctgccc
cccaatgagtgcggccgccgcccaggcttctccaagccccagagggtcgtggggggcacc
gccgcccttcacggggaggtcccgtggcaggtgagcctgaaggaggaggggctgcggcac
ttctgcggggccgccgtcatcgccccccgctggctgctctcggccgcccactgcttcaac
cagaccaagccgggccgtgtgacagcctttgcgggcagcacgcttctctccgtgtccgag
agcggctccgtcaaggcgggcatccggcgggtgctgccccacccctccttccgccccggc
cggccggacttcgacgtggccctcgtggagctgctgcggcccctgcccttcggggcgagc
gtccagcccgtctgcctcccgcccgccggccccaagttccctctcggcaggaagtgcttc
gtctccggctgggggagcctccgggatggtgacgccccccggccggagaccctgcaactc
gcctcggtgcggatcgtggagcaggcggcctgcagcgccctgtacggcttctccctcacg
gagcagatcatctgcgccgggttcctggaggggaaggcgggggcttgccagggcgactcc
gggggtcccttggcgtgtgaggaggcccccggcgtgttctccctggccgggctggtcagc
tggggagtgggctgcactccggccaagcgccccagggtctacgcccgcgtcagccgcttc
acggggtggatcctggagaccgtggccgcccccgtgggaccctcctctccccccaagaag
ggccggaccaccaccgccgtcgccgtggcccactcctccttgacctccacctctggtcag
agctcgacgtggccggactccaccagtacccgtctccgtacgaccggactcccggaggtc
accccgatgccagagtgtggccggtccccctcccggtggctgggccggatcgtggggggc
agcggggcccggcggggggagtggccgtggcaggcgagcctccagctgcgtcgcgggaag
agggcggagcacaagtgcggtgctgtcctggtggccccgcagtggctcctctcggccgcc
cactgcttcgacctgcacggcgacccctcctcgtggctggcggtgctggggacgcccttc
ctggaggaggcggacggagaggcggagacgcgtggggtgtcgcacctgctccgccacccc
ttctacaacggcgtcacgctggactacgacctggccctgctgcgcctggaccgccccctg
cgcccctcgcccgccgtccggcccgtctgcctccccggccgcggacccccaccgcccccc
ggggccccctgcgtcatcaccgggtgggggtccacccacgagggagggccgatgtcgcgt
cggctgcagcaggcgagggtggcggtggtggcggaggccgagtgccggcgcttctacccg
gtgcagatcagcagccgcatgctgtgcgcggggtccccccggggggctgtcgacagctgc
tccggtgacgcggggggcccgctggcctgccgggagccctcctcctcctcctgggtcctg
gccggagtcaccagctggggctacgggtgcgcccggcccgccttccccggggtctacgcc
agcgtggcccccgcccggggctggatccgccagcacctccgcccctga

DBGET integrated database retrieval system