KEGG   Anolis carolinensis (green anole): 100565405
Entry
100565405         CDS       T01608                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00232  Caffeine metabolism
acs00983  Drug metabolism - other enzymes
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100565405
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100565405
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100565405
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-GeneID: 100565405
NCBI-ProteinID: XP_008120442
LinkDB
Position
Un
AA seq 288 aa
MNVEEYFARTGYKGSLEKLDLETLRAIFQHHIRAVPFENLSVHCGETITLDLEDVYEKIV
RKRRGGWCMENNQLLLWVLQTLGFDTTPLGSYVYNPQQGEYETDMNHLIMKVVIDSTTYI
VDGGYGSYYQMWEPMELVSGKDQPQTPGIFRFTEEKGTWYLEKVRRKQHVPDPDFSHLVG
KVGCRNIYSFNLKPVTMEDFQPQCLNLQTSPNSLFTRKSICTLQTAVGFRALVGWTFSET
TYGYEEDTDLVEFKALRDEEVEPTLREEFGISLERKLASINLPGNYDV
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaacgtggaagagtatttcgcgagaaccggctacaaaggctccctggaaaagctcgat
ctggaaacgctgagggccatcttccagcaccacatccgggccgttccctttgaaaacctg
agcgtccactgcggggagaccatcacgctggacctggaggacgtctacgagaagatcgtg
cgcaagaggcggggtgggtggtgcatggagaacaaccagctgctcctttgggttctccag
accctggggttcgacaccacccccctggggtcctatgtctacaacccacagcaaggcgaa
tacgagacggacatgaaccacctcatcatgaaggttgtaattgacagcacaacgtatatt
gttgacggtggttacggctcctactaccaaatgtgggagccgatggagctggtgtccggc
aaagaccagcctcaaacaccggggatctttcgcttcacggaagagaaggggacgtggtac
ttggagaaagtcaggaggaagcaacacgttcccgatcccgacttcagccatcttgtaggg
aaggtgggatgcaggaacatctactcgttcaacctgaagccggttacgatggaggacttc
cagccccaatgtttgaacctccaaacgtcccccaattccctgtttacacgcaagtccatc
tgcaccctccagaccgcggtcggcttccgggctctggttgggtggaccttctcagagacc
acgtacggctatgaggaggacacggacctggtggagttcaaggccttgcgggacgaggag
gtggagccgaccctgcgagaggagtttggcatctccttggagaggaagctggcctcgatt
aacctccccgggaactatgacgtctag

DBGET integrated database retrieval system