KEGG   Anolis carolinensis (green anole): 100565521Help
Entry
100565521         CDS       T01608                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs03030  DNA replication
acs03410  Base excision repair
acs03420  Nucleotide excision repair
acs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100565521 (lig1)
   03410 Base excision repair
    100565521 (lig1)
   03420 Nucleotide excision repair
    100565521 (lig1)
   03430 Mismatch repair
    100565521 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100565521 (lig1)
   03400 DNA repair and recombination proteins [BR:acs03400]
    100565521 (lig1)
Enzymes [BR:acs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100565521 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100565521 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100565521 (lig1)
DNA replication proteins [BR:acs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100565521 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100565521 (lig1)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100565521 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     100565521 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     100565521 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 100565521
NCBI-ProteinID: XP_003224638
Ensembl: ENSACAG00000011085
UniProt: H9GHC9
LinkDB All DBs
Position
Un
AA seq 913 aa AA seqDB search
MQSTIRSFFQPLTQAKPGKGVAENSEEETTPKKKPVNSEKPVNGTALCANIPENSSAKKD
EDNSVKSEGGKDTKSGESKQESICLPEQSKPVENNSPSTSPAASNSPSPSSIPRRKTARK
QVPKRKLEDEVNSYNNSQEVLSAKRQKGDDDGDGSHGESDAKPMQVKEVKDKKEEDSELV
EREEETEAEEKKMLTSSKLSNKAISSFFAPRKTSVKADKKQTPGSEENVPPAKSHNEGKN
HESNSVAKDSPKASPTLEPSEYNSAKSNYHPIHDACWGSGQRVPYLAVARTFEWIEQESA
RLKIIETLSNFFRSVIALSPEDLLPCVYLCLNRLGPAYEGLELGIGKTILMKALAQATGR
QLDQIKAEAAEKGDLGLVAESSRTTQGTMFAPPKLGAGAVFGKLQAIGRMMGSSSMNKKI
DIIKSLFVACRHSEARYIARSLEGKLRIGLAEQSVLSALAQAASLTPPGQKFPPEILDAS
KGKSAETRKSWLDERALIVKQAFCELPNYDIIVPVLLEHGVESLPKHCKITPGIPLKPML
AHPTKGIGEVLKRFEEAAFTCEYKYDGERAQIHILENGEVHIYSRNQENNTTKYPDIVSR
IPKVKKSTVESCILDAEAVAWDPDSKQIQPFQVLTTRKRKDVDTEDIRVQVCVYAFDMLY
LNGQSLVREPLTQRRTLLRDSFTEVEGQFLFATSMDTSNTDEIAEFLERSIKDSCEGLMV
KTLEVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGKGKRAGIYGGFLLACYD
DESEEFQSICKIGTGFTDEDLEKLHTSLKAHVIPQPRPYYRWGGTAEPDHWLETHHVWEV
KCADLSISPVHRAAAGLVDEEKGISLRFPRFLRLRDDKKPEEATTSAQVAELYRKQQQIQ
NQQSVENGNDDFY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacaataagatcgttcttccagccactaacacaggcaaagcctggaaaagga
gtagcagaaaacagtgaagaagaaaccactcccaaaaagaaaccagtaaactctgaaaag
ccagtaaatggtacagcactctgtgcaaacatcccagagaattcatcagccaaaaaagat
gaagacaattctgtgaaatcagaggggggaaaagatacaaagtctggtgagagcaagcag
gaatctatctgtcttcctgagcaaagtaaacctgttgagaacaactccccaagtaccagc
ccagctgcatctaattcaccctcaccttctagcatcccacgacgcaagactgctcgcaag
caggtccctaaacgtaaattagaggacgaagtcaacagctataataattctcaggaggtt
cttagtgccaagaggcagaaaggagatgatgatggagatggttcacatggagagtcagat
gcaaaacccatgcaagtgaaagaagtgaaagacaagaaagaagaggattcagaattggta
gagcgtgaagaagagacagaagcagaagaaaagaagatgcttacatcctctaagctatcc
aacaaggccatctctagcttttttgcccccaggaaaacctctgtgaaagcagacaaaaag
cagacacctggctcagaagaaaatgtgcctccagcaaagagtcataatgaaggcaaaaac
catgagtcaaatagtgtggctaaagattctccaaaggcctctcccacacttgagccttca
gagtacaactcggcaaagagcaactatcatcctatccatgatgcttgttggggttctggt
cagagagtaccatacctggctgtggctcgtacctttgagtggattgaacaggaatctgcc
cggttgaaaattatagagactttgagcaatttttttcgctctgtgattgccctatctcct
gaagacctgctgccctgtgtctatctttgtctgaatcggctaggcccagcatacgagggt
ttagaactgggtattggcaaaaccatcctcatgaaagctttggctcaggccacaggtcgg
cagctggatcagatcaaggcagaggcagctgagaaaggagatctgggattagttgctgaa
agcagccgcaccacacaaggcaccatgtttgccccaccgaagcttggtgcgggtgcagtc
tttggcaaactgcaagcaattgggcgcatgatgggaagctcttccatgaacaagaaaatc
gacataatcaagtccttgtttgttgcttgtcgccactcagaggctcgctacattgctcga
tcactggaagggaagctgcggattggattagcagaacaatctgtcctatcagctctggcc
caggcagcatcactcactcctccagggcaaaaattccccccagaaattctggatgcttca
aaaggcaaatctgcagagacccgcaaatcctggctagatgagagagccttgattgttaag
caagccttctgtgaactgccaaattatgacatcattgtgcctgtcctcctagagcatggt
gtggagagcctgcctaagcactgcaaaatcacaccaggaatccccttaaagcccatgctg
gctcacccgacaaaaggaattggagaagtattaaagcgttttgaagaagccgcttttacc
tgtgaatataaatatgatggggagcgagcacagatccacatcctggagaatggagaagtg
catatctacagccggaaccaagagaacaacacaaccaaataccctgacattgtgagccgt
atccccaaggtaaaaaagagcactgtagagtcgtgtatcttggatgcagaagctgtggcc
tgggatccggattccaaacagatccagccattccaagtactgactactcggaagcgtaaa
gatgtagatactgaagatatccgagtgcaggtctgcgtatatgcatttgacatgctctac
ctcaatgggcagtctctggtccgggaacccttaacccagcgccgaaccctactacgggat
tccttcactgaggttgaaggtcagttcctctttgccacctccatggacacaagtaataca
gatgagatagcagagttcctggaacgctccatcaaagactcttgtgaggggctaatggta
aaaacattggaagtggatgccacatatgaaattgcaaagagatcccacaactggctgaag
ctgaaaaaagattatctggatggtgtgggggacactctggacctggtggtgattggtgcc
tacttggggaagggaaagcgtgcaggcatctatggcggcttcctcctggcttgttatgat
gatgaaagcgaggagttccagagcatctgcaagattggcactggatttacggatgaggac
ctcgagaaacttcatacctctcttaaggcccatgtcattccacagccacggccatattac
cgctggggtggcacagcagagcctgaccactggctggagacacatcatgtctgggaagtg
aagtgtgctgacctgtcaatttctcccgtccacagagcagcagctggactggtggatgaa
gaaaagggcatctccctgcgcttccccagattcctacgcctccgagatgataagaaacca
gaggaagccactaccagcgctcaggtggctgagctataccggaaacagcaacagatccag
aatcagcagtcagtggaaaatggaaatgatgatttctactag

DBGET integrated database retrieval system