KEGG   Anolis carolinensis (green anole): 100565603Help
Entry
100565603         CDS       T01608                                 

Definition
(RefSeq) cationic trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100565603
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100565603
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100565603
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100565603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 100565603
NCBI-ProteinID: XP_003227623
Ensembl: ENSACAG00000007958
UniProt: H9GDA9
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MKLLLVLAFLGAAVAAPLDDDDDKIVGGYTCQRNSVPYQVSLNAGYHFCGGSLIQDRWVL
SAAHCYKSRIQVRLGEHNIMELEGGEQFVDSEKVIRHPQYNSWLLDNDIMLIKLKDRAEL
STRIAPIALGKGCAATGTSCLISGWGNTLSDGVNYPDLLQCLDVPILSDEDCRNAYPGQI
TDNMICIGSLAGGQDSCQGDSGGPVACNGVLQGIVSWGIGCALPGYPGVYTRVCNYIDWI
NETMNAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctcttggtcttggcttttctgggtgcagcagttgctgcccctttggatgat
gacgacgacaagattgttggtgggtacacttgccagagaaactctgttccctatcaggtg
tcactgaatgctggataccatttctgtggtggttccctcatccaggacagatgggtgctt
tcagctgctcattgctacaaatcccgcatccaagtaaggcttggagagcacaacattatg
gagctggaagggggggagcagtttgtcgactctgaaaaagtcattcgccatccccaatac
aactcttggctcctggataacgacattatgctgatcaagctgaaagaccgtgctgaactg
tccacacgcattgcacccattgctttgggaaaaggatgtgcagctactgggactagctgt
ttgatatctggatggggcaacacactcagtgatggggtaaactaccctgaccttctgcag
tgcctggatgttccaatcctatctgatgaagattgcagaaatgcttacccaggacaaatc
actgataatatgatctgtattggatccttagcgggtggccaagactcctgccagggagat
tctggtggcccagtggcatgcaacggagtgctccagggcattgtttcatggggaataggg
tgtgctttgcctggttaccccggtgtctacaccagggtctgcaactatatcgactggatc
aacgaaaccatgaatgccaattaa

DBGET integrated database retrieval system