KEGG   Anolis carolinensis (green anole): 100565795Help
Entry
100565795         CDS       T01608                                 

Definition
(RefSeq) trypsin I-P38
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100565795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acs01002]
    100565795
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100565795
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100565795
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100565795
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100565795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100565795
NCBI-ProteinID: XP_003227624
Ensembl: ENSACAG00000007893
UniProt: H9GD79
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MKSILLVAFLGVALAFPIDDADDDKIVGGYTCQRGSVPYQVSLNSGYHFCGGALISNQWV
VSAAHCYKSRIQVRLGEHSLSLNDGSEQYINSAKIIRHPSYNSRLLDNDIMLIKLSTTAN
LNSRVTSVSLPSSCVSTGTQCLISGWGNTLSSGTNYPDTLQCLKAPVLSSTQCQNAYPGQ
ITNNMICIGFLEGGKDACQGDSGGPVVCNGQLQGVVSWGIGCAQRGYPGVYTKVCNYVSW
IQNTVRSN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccattttgctcgtagcctttctgggagtggctcttgccttccccatcgatgat
gccgatgatgataagattgtgggaggatacacctgccagagaggttcagtcccctatcaa
gtctcactaaattctggataccacttctgtgggggtgccctcatcagcaaccagtgggtt
gtgtcagctgctcactgctacaaatcacgaatccaagtgagacttggagaacacagtttg
tccttaaatgatggctctgagcagtacataaattcagccaaaatcatccgtcatcccagc
tacaactcacgactcttggacaacgacatcatgctgatcaagctgtccacaacagccaac
ctcaacagccgagtcacatccgtctctctacccagcagctgtgtctcgactgggacacag
tgtctcatttctggttggggtaacacactcagcagtggcactaactatcctgacacgctg
cagtgcttaaaggctcctgtactgtcttctactcaatgccagaatgcttatccaggacaa
atcacaaacaatatgatatgtataggatttttggaaggtggcaaagatgcttgccagggt
gactcaggtggccctgtagtctgcaatggacagctccagggtgtcgtctcctggggcatt
ggatgtgctcagaggggctatcctggagtctataccaaggtctgcaactacgtttcatgg
attcaaaacaccgtacgttccaactga

DBGET integrated database retrieval system