KEGG   Anolis carolinensis (green anole): 100565834
Entry
100565834         CDS       T01608                                 

Gene name
pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04020  Calcium signaling pathway
acs04144  Endocytosis
acs04510  Focal adhesion
acs04540  Gap junction
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100565834 (pdgfra)
   04020 Calcium signaling pathway
    100565834 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100565834 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100565834 (pdgfra)
   04540 Gap junction
    100565834 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100565834 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100565834 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:acs04090]
    100565834 (pdgfra)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100565834 (pdgfra)
Protein kinases [BR:acs01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100565834 (pdgfra)
CD molecules [BR:acs04090]
 Proteins
  100565834 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 100565834
NCBI-ProteinID: XP_003221608
Ensembl: ENSACAG00000010297
UniProt: G1KK54
LinkDB
Position
5
AA seq 1088 aa
MMGPSQRTYLILGCFLTGPWLASCQTLFPTIFPNKDEMEVHLNSPFTLKCSGDSEVNWQH
PIPEDNDTIDIRNEENNSGLFVTVLEVKNASASHTGLYTCYYNHSQEEEGEVEGKDIYIF
VPDPAVPFVPTSPEDSIIVITEEDETSTIPCRTSDPHAQVTLTNSEGKVVYTFYDNRQGF
IGNFSAGSYTCRTTVKAVEFLSGEFFVYVYKATSHLQVEVGSLKTVYKTGETIVVTCVVL
DNEVVNLEWKYPGKVRNRGIISLEDIKVPAQKLIYNLTIHDASVSDSGDYECAAHHVTKE
LKKTKRTIITVHDKGFIRLEPHFNPMETVNLHEVKKFVVGVHAYPEPRIFWLKDNITLME
NLTEIVTSFKQIQETRYQSVLKLIRAKEEDSGYYTLVAQNEDEIQRYTFSLLIQVPALIR
DLVDNHHGSAGQTVKCLAEGTPLPDVEWLICKDIKRCSNDTSWTPLTNNISDITMETHLD
ERNMVESQVTFQKVQETLAVRCLARNDLGTVARELKLVAPTLRSELTLAAAILVLLVFVI
ISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARTSEKQALMSELKIMTHLGPHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRNPEKTKKDLDIFGMNSADESTRS
YVILSFENNGEYMDMKQAETTQYVPMLERRDRSKYSDIQRSLYDRPASYKKKYLSEQDVL
NLLSDDNSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMTKPDHATSEVYDIMVKCWNSEPEKRPSFYHLSEIVENLLPGEYK
KSYERIHLDFLKSDHPAVTRMRADCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYII
PLPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFVKREDETIDDIDIIDDIGMDSS
ELVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgatgggtccttctcaaaggacatacctgatcctgggctgcttcttgacaggtccatgg
ttagcctcctgccagactttgtttcctactatttttccaaacaaagatgaaatggaggtg
catctgaattcccccttcaccttgaaatgttccggagacagtgaagtaaactggcagcac
ccaatacctgaagacaatgatactatagacatcagaaatgaagaaaacaatagcggcctt
tttgtcactgtgctggaagtcaaaaacgcatctgcttcccatactggactgtatacttgc
tactacaatcattcccaagaagaagaaggggaggttgagggaaaggatatctatatcttt
gtgccagatccagctgtcccctttgtccctacatctcctgaagattcaatcattgttatt
actgaagaagatgagacctccaccattccttgccgcacgagtgatcctcatgctcaagta
actttaacaaacagcgaagggaaagtcgtgtacaccttttatgacaacaggcaaggcttc
attggaaacttctctgcaggctcctatacatgcaggaccactgtgaaggccgtggagttc
ctgtctggtgaattttttgtctacgtttacaaagcaacttcacatcttcaagttgaggtt
ggatcccttaagactgtgtataaaacaggagaaacgattgttgtaacttgtgtggtcttg
gataatgaagttgtgaacttggagtggaaatatccagggaaagtgaggaacagaggtatc
atctcactcgaagacatcaaagtgccagcccagaaactgatttataacttaaccattcat
gatgcttcagtaagcgacagtggagattacgaatgtgcagctcatcatgtcaccaaagag
ttaaagaaaacaaaaagaaccatcattacagttcatgataaagggttcattcgtctggag
ccccattttaatcccatggaaacagtcaatctgcatgaagttaaaaaatttgtagttggt
gtgcatgcatatccagagccaagaatcttttggctaaaggacaatatcactctgatggag
aatctcaccgagattgtcactagtttcaagcagatccaggagacgaggtaccagagtgtg
ttaaaattaattcgtgccaaggaagaagacagtgggtactacactcttgtagcacagaat
gaagatgaaattcaaagatatactttctctctgcttatacaagtgccagctttaattcga
gacctagtagataatcaccatggctctgctgggcaaactgtgaaatgcttggctgaaggg
acacctctccctgatgtggaatggttgatttgcaaggatataaaaaggtgcagcaatgat
acttcgtggactcccctgactaacaatatctctgatattactatggagactcatctggat
gagaggaacatggtagagagccaggtgacttttcagaaggtgcaagaaacgttggctgtt
cgatgcctggcaaggaatgaccttggaaccgtagcacgggaactgaagcttgtggctcca
actttaagatcagaattgactctggctgccgcaatcctagtgttgctagtgtttgtaata
atttcgctgattgtcctggttatcatatggaaacagaagccaagatacgaaattagatgg
agagtcatcgagtctatcagcccagatggccatgaatatatatatgtggatcccatgcag
ctgccttatgattcaagatgggaatttcctagagatggattagtgctgggccgaattctt
ggctccggagcttttggaaaagtagttgaaggaaccgcatatggattaagtcggtcacag
cctgtcatgaaggtggctgtgaaaatgctgaagcccactgcacgaaccagtgaaaagcag
gctctcatgtctgaattaaagataatgacccatcttggaccccacttgaacatagtcaac
ctgttaggagcatgtacaaaatcaggtccaatttacatcataacagaatactgcttttat
ggagacttggtgaactatctgcataaaaacagggacaactttctgaaccgaaaccctgaa
aagacaaagaaagatttggacatctttgggatgaactcggctgatgaaagcactaggagc
tatgtcatcctgtcatttgaaaataatggtgaatacatggatatgaagcaagcagagacc
acacagtatgtgccgatgctagaaaggagagacaggtcaaaatattctgacatccagaga
tctctgtatgatagacctgcttcatataagaaaaaatatctgtctgaacaagatgttctg
aatcttctttcagatgataattcagaaggcctcagtttgctggacctattgagctttacc
taccaagttgcccggggaatggagttcttagcatcgaaaaattgtgtacaccgtgatttg
gcagcaaggaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttggtctg
gctagagatattatgcatgattcaaactatgtctccaaaggcagcaccttccttccagtg
aagtggatggcacctgagagcatttttgacaacctatatacaacattaagtgatgtttgg
tcttatggcattctgctctgggaaatattttctcttggtggcaccccatatcctggcatg
atggttgattctacattctataacaaaatcaagagtggatatcgaatgacaaaacctgac
catgctaccagtgaagtgtatgacatcatggtaaaatgctggaacagcgaacctgagaag
agaccctctttttaccacttgagtgaaatagttgagaatcttttgcctggagaatacaag
aagagctatgagagaattcacttggacttcctgaagagtgaccatcctgctgtcacacgc
atgcgagcagactgtgacaacacttacattggtgttacttacaaaaatgaagacaaactg
aaagatagggagagcggctttgatgaacaaagactaagtgctgacagtggatacatcatt
cctctgccggatattgaccctgtctcagaagatgaacttggcaaaaggaacaggcatagt
tcccagacctctgaagaaagtgccattgaaaccggatccagcagttcgacctttgtcaag
cgagaggatgaaaccattgatgacatcgacattattgacgacattggcatggattcctcc
gaattggttgaggacagcttcctgtaa

DBGET integrated database retrieval system