KEGG   Anolis carolinensis (green anole): 100565907
Entry
100565907         CDS       T01608                                 

Gene name
igfbp3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100565907 (igfbp3)
   04218 Cellular senescence
    100565907 (igfbp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100565907 (igfbp3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100565907 (igfbp3)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    100565907 (igfbp3)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100565907 (igfbp3)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 100565907
NCBI-ProteinID: XP_003222270
Ensembl: ENSACAG00000008077
UniProt: G1KHC6
LinkDB
Position
6
AA seq 292 aa
MGSRLSWLLWAVAALAALQSRLAAALAGPVVRCEPCGSGALERCKPLAPECPEPVREPGC
GCCWTCALREGQPCGVYTERCGAGLRCRPRSQEPKPLQALLDGKGLCANVSGEAARGGDR
GRGSSLRELLLSVAHVPGNSSDSDEDQNISGMATQSVPSTHRLLESRSHGHHTKIDTIRK
EHAKNTQRYKYDSQSTDMLNFSSESKQDIEYGPCRREMEDTLNHLNILNVLSPGGLHIPN
CDKRGFYKKKQCRPSRGRKRGYCWCVDKYGQPLPGYDEKGKEDIHCYNFESK
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggatcgcggctctcctggctgctgtgggcagtggcggcgctggcggcgctgcagagc
cggctggcggcggcgctggcggggcccgtggtgcgatgcgagccgtgcggctctggggct
ctggagcggtgcaagcccttggcgcccgagtgccccgagccggtgcgggagccgggctgc
ggctgctgctggacgtgcgccttgcgcgagggacaaccctgcggcgtctacactgagcgc
tgcggcgctggcttgcgctgccggccccgaagccaggagccgaagccgctgcaggcgctg
ctcgacggcaaggggctctgcgccaacgtcagcggcgaggcggcgcgaggaggagacaga
ggcagaggcagcagcctgcgcgagctcctcctgagcgtggctcacgtgccaggtaattca
agtgattcagatgaagatcagaatataagtggcatggcgactcaatctgtccccagtaca
cacaggctgttggaatccaggtcacatggtcatcacacgaaaatagataccatcaggaaa
gagcatgccaaaaatacccagcgctacaaatacgattcacaaagcacagacatgctgaat
ttttcttcggaatccaaacaggatattgaatatggaccatgtcgaagagaaatggaggat
acgttaaatcacctaaatattctgaatgtcttaagtccaggaggactgcatattccaaat
tgtgacaaaaggggtttctacaagaaaaaacagtgccgtccatcaagaggccgaaaaaga
ggctattgctggtgtgtggataaatatggacagccactccctggatatgatgaaaaagga
aaagaagatattcattgttacaattttgaaagcaagtga

DBGET integrated database retrieval system