KEGG   Anolis carolinensis (green anole): 100566226
Entry
100566226         CDS       T01608                                 

Gene name
rrm2b
Definition
(RefSeq) ribonucleotide reductase regulatory TP53 inducible subunit M2B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00230  Purine metabolism
acs00240  Pyrimidine metabolism
acs00480  Glutathione metabolism
acs00983  Drug metabolism - other enzymes
acs01100  Metabolic pathways
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100566226 (rrm2b)
   00240 Pyrimidine metabolism
    100566226 (rrm2b)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100566226 (rrm2b)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100566226 (rrm2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100566226 (rrm2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acs03400]
    100566226 (rrm2b)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100566226 (rrm2b)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100566226 (rrm2b)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100566226
NCBI-ProteinID: XP_008106498
Ensembl: ENSACAG00000008913
UniProt: G1KIC0
LinkDB
Position
4
AA seq 344 aa
MGEPGSEASRLFSDGLENGLKSNEEPLLRKNPRRFVIFPIHYPDIWKMYKKAQASFWTAE
EVDLSKDFPHWNKLKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQ
ILIENVHSEMYSLLIDTYIKDPEERDFLFNAIETMPCVKKKADWALRWIRDRKATFGERV
VAFASVEGIFFSGAFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPS
EERVREIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLLELGFSKVFQAEN
PFDFMENISLEGKTNFFEKRVSEYQRFAVMAETNDNVFTLDADF
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgggcgagccaggcagcgaggcctcgaggttgttctctgatggtcttgaaaatggcttg
aaatcaaatgaggagcccttgttaagaaaaaatcctcgacggtttgtcatcttcccaatc
cactatcctgatatctggaaaatgtacaagaaagctcaagcttctttctggacagcagaa
gaggttgacctatctaaggacttccctcactggaacaagctgaaatcagaagagaaatat
tttatttcacacatcctggcattttttgcagctagcgatggaattgtgaatgaaaacttg
gtggaacgctttagtcaggaagtgcaagtcccagaggctcgttgtttctatggctttcag
atcctaatcgaaaatgttcattcagagatgtacagtttattaatagacacttacatcaag
gatcctgaggaaagggatttcttatttaatgcaatcgaaacaatgccatgtgtcaagaag
aaagcagactgggcactacggtggatacgagataggaaagccacgtttggggagagagtg
gttgcttttgcctcggttgaaggaatcttcttctctggtgcctttgcagctatcttttgg
ctcaagaaaagaggactgatgccgggtctcactttctccaatgaacttattagccgtgat
gaagggctccattgtgactttgcctgcctaatgtttcaatacttagtgaataagccttca
gaggaaagagtcagagagatcattgtcaatgctgttgaaattgaacaggagtttttgact
gaggccttgccagttggcttgattggaatgaattgcactctaatgaaacagtatattgag
tttgtggctgacaggttacttctggaactgggcttctccaaggtctttcaagcagaaaac
ccttttgatttcatggagaacatttctttggaaggaaaaaccaatttctttgagaagaga
gtttcagagtatcagcgttttgcagtgatggccgaaacaaatgacaatgtgtttacttta
gatgctgacttctag

KEGG   Anolis carolinensis (green anole): 100568029
Entry
100568029         CDS       T01608                                 

Gene name
rrm2
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00230  Purine metabolism
acs00240  Pyrimidine metabolism
acs00480  Glutathione metabolism
acs00983  Drug metabolism - other enzymes
acs01100  Metabolic pathways
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100568029 (rrm2)
   00240 Pyrimidine metabolism
    100568029 (rrm2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100568029 (rrm2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100568029 (rrm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100568029 (rrm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acs03400]
    100568029 (rrm2)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100568029 (rrm2)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100568029 (rrm2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100568029
NCBI-ProteinID: XP_003215473
LinkDB
Position
1
AA seq 490 aa
MFLPAVRALGTLLLSRRSANRGAEREERWQTSPRFRSRSFHQWERTFRLIGPSVHSGAMF
ERDINRQNEPAASPLLLNSQKKLQLAFPLYVFPAENMLASRNAFSARNEQQPKSSLSPLK
KLALNDKENTPPSFSSTRVLASKAARKIFQESEADALKGGKQLPSNNAQDEPLLRDNPHR
FVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKPDEKYFISHILAFFAASDG
IVNENLVERFSQEIQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIET
LPCVKRKADWAMRWIGDKHATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSN
ELISRDEGLHCDFACLMFKHLVHKPSEERVREIITNAVRIEQEFLTEALPVNLIGMNCTL
MKQYIEFVADRLILELGFNKIYKAENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSKAV
DNSFTLDADF
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgttcttgcccgcagttcgcgccttggggactcttttgttgtcccggcggtcggccaat
cgcggcgcagagcgggaagaacgctggcagacttccccgcgtttccgaagccgctcgttc
caccaatgggagcgcaccttccgcctgattggcccgtcggtgcattctggcgccatgttc
gaaagggatataaaccgccaaaacgagccggccgcctctcctctattacttaactctcag
aagaagctccagcttgccttcccgctctacgtttttcccgctgaaaatatgctggccagc
cgtaatgcgttttcggctcgcaacgagcaacagcccaaatccagcttgtcgcctctgaaa
aaattggctttgaacgacaaggagaacacacctccttcattcagctctactcgggttctg
gcttccaaggcggcaaggaagatctttcaggagtctgaggcggatgcattgaaaggaggg
aagcagcttccttcaaataatgcacaggatgaaccacttcttcgggataatccacaccgc
tttgtgatctttcccattcagtaccatgacatttggcaaatgtacaagaaagcagaagct
tcattttggacagcagaagaggtggatctctctaaagatctccagcattgggaatcctta
aaacctgacgagaagtatttcatttcacacatcttggcattctttgctgcaagtgatggc
attgtcaacgaaaatttggtggagcgattcagccaagaaatccaagtcacagaagctcgc
tgtttctatggcttccagattgccatggaaaacatccattcggaaatgtacagtttactt
attgatacttacatcaaagaccccaaagagagggaatatctgttcaatgccatcgaaacc
ttgccatgtgttaaaaggaaagccgactgggccatgcggtggattggagacaaacatgct
acttatggggaacgagtagtagcctttgctgcagtagaaggaatcttcttttccggttct
tttgcatctatattttggttgaaaaagcgaggtctgatgcctggactcactttctccaat
gaactgatcagtagagatgagggtttgcactgcgactttgcttgcctaatgttcaaacac
ttggtacacaaaccatcagaggaaagagtgagagagataattacaaacgctgtcaggata
gagcaggaattcttgacagaagccttgcctgtaaacctaattggcatgaattgcacttta
atgaagcagtatattgaatttgtggcagacagactgatactggaattgggttttaacaag
atatacaaagctgagaatccgtttgacttcatggagaatatctcactggaaggcaaaact
aatttctttgaaaagcgtgtcggagaatatcagaggatgggagtgatgtcaaaagctgta
gacaattctttcaccttggatgcagatttctaa

DBGET integrated database retrieval system