KEGG   Anolis carolinensis (green anole): 100566575
Entry
100566575         CDS       T01608                                 

Gene name
ei24
Definition
(RefSeq) EI24, autophagy associated transmembrane protein
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100566575 (ei24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 100566575
NCBI-ProteinID: XP_003225768
Ensembl: ENSACAG00000000120
UniProt: H9G3B1
LinkDB
Position
Un
AA seq 340 aa
MADSVKIFLNDVIRGIKDSIWGICTISKLDARIQQKREEQRKRRASSVLAQRRAQSEERK
QETEPRIVSRIFQCCAWNGGVFWLSLFLFYRVFIPVLQSATAHIIGDPSLHGDVWSWLEF
ILTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPQPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDIIGQLVGLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYHFQLRLFSLVVFL
SNKLFHKTVYLQSTLSSSSSADRLPSPHSSPARQKAALSH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcagatagtgtcaagatcttccttaatgatgtcatcaggggaattaaagattccata
tgggggatctgcactatctccaagctggatgctcggatccagcagaaaagggaggaacag
cgaaaaaggagagcaagcagtgtccttgcccagcgaagagcacagagtgaggagaggaag
caggagactgaaccccggatagtaagccgaatatttcagtgttgtgcatggaatggaggt
gtattctggcttagtctcttcttgttctatcgagtattcatccctgttcttcagtcagca
acagcacatataattggtgacccttctttacatggtgatgtctggtcatggttggaattc
atcctcacatccatcttcagtgctctttgggtccttcctctctttgtccttagcaaagtt
gtcaatgccatctggttccaggatattgctgacctggcatttgaagtgtcaggaaggaag
cctcagccttttcccagtgtcagtaaaattattgctgatatgttgtttaaccttttactg
caagctctctttctcatccaggggatgattgtaagtttgtttcccattgatatcataggc
cagctggtcggcctgcttcatatgtcgttgctctactctctgtactgttttgagtaccgt
tggtttaacaaaggaattgaaatgcatcaacgattatccaatatagaaaggaactggccc
tattactttggatttggtttaccactggcctttcttactgcaatgcagtcttcttacatt
atcagcggctgcctgttttccatcctttttcctctgtttatcatcagcgccaatgaagca
aagacaccaggaaaagcataccacttccagttgcgcctcttttccttggtggtcttcctt
agcaacaaactctttcataagacagtttaccttcagtctaccctgagcagttcttcttca
gccgatcgcctgccctcaccacattcgtcgcctgcccggcaaaaggctgctttgtcacac
tga

DBGET integrated database retrieval system