KEGG   Anolis carolinensis (green anole): 100566682
Entry
100566682         CDS       T01608                                 

Gene name
igf1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04068  FoxO signaling pathway
acs04114  Oocyte meiosis
acs04115  p53 signaling pathway
acs04150  mTOR signaling pathway
acs04510  Focal adhesion
acs04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100566682 (igf1)
   04068 FoxO signaling pathway
    100566682 (igf1)
   04150 mTOR signaling pathway
    100566682 (igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100566682 (igf1)
   04115 p53 signaling pathway
    100566682 (igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100566682 (igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100566682 (igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acs04052]
    100566682 (igf1)
Cytokines and growth factors [BR:acs04052]
 Growth factors
  Growth factors (RTK binding)
   100566682 (igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100566682
NCBI-ProteinID: XP_008108776
Ensembl: ENSACAG00000016515
LinkDB
Position
5
AA seq 181 aa
MGKINSLSTQLFKCCFCDFLKVKMLTVSYVHLFYFGLCFLILTSSSPAAGQETLCGAELV
DALQFVCGERGFYFSKPAGYGGNRRSIAARGIVDECCFQSCDLTRLEMYCAPVKPPKSAR
SVRAQRHTDMPKAQKNFAQQKTRGQYVSVSMGKSRRVNTKDRKRNLINQKKTSIKGTAVR
K
NT seq 546 nt   +upstreamnt  +downstreamnt
atgggaaaaatcaacagtctttcaacacaattatttaagtgctgcttttgtgatttcttg
aaggtcaagatgctcacagtgtcctatgttcatctcttctactttggcctgtgctttctc
attttgaccagttcgtctcctgctgctggccaagagacactttgtggtgctgaattggta
gatgctcttcagtttgtctgcggagaaagaggcttctattttagcaaacctgctggatat
ggaggcaatcggcgttcaattgctgctagaggaatagtggatgaatgttgctttcaaagc
tgtgacctgacacgactggagatgtactgcgctcctgttaaaccacctaaatccgcacgg
tctgtacgtgcgcagcgccacactgacatgcccaaagcacaaaagaatttcgcacaacaa
aaaacccgtgggcagtatgtatcagtatctatgggaaaaagcaggagggttaacacaaag
gacagaaagagaaacttaataaaccagaagaagacatcaatcaagggaacagctgtcagg
aaatag

DBGET integrated database retrieval system