KEGG   Anolis carolinensis (green anole): 100566951
Entry
100566951         CDS       T01608                                 

Gene name
ctnnb1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04310  Wnt signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04916  Melanogenesis
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100566951 (ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100566951 (ctnnb1)
   04520 Adherens junction
    100566951 (ctnnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100566951 (ctnnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100566951 (ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100566951
NCBI-ProteinID: XP_003224002
Ensembl: ENSACAG00000004408
UniProt: H9G974
LinkDB
Position
Un
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWDQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRPDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggcaacccaagctgacttgatggagctggacatggcaatggagccagataggaaagca
gctgtcagccactggcagcaacagtcctacctagattctggtattcactctggtgccaca
acaacagccccatctctgagtggcaaaggaaatcctgaagaggaagatgtcgatactacc
caagttctgtatgagtgggaccaggggttctctcagtccttcacccaggaacaagttgct
gatattgatgggcaatatgccatgactcgagcacagagagtgcgtgctgccatgtttcca
gaaacattggatgaaggcatgcaaattccatcaacacagtttgatgcggctcatccaacc
aacgtgcagcgccttgccgaaccttcccagatgttaaaacatgctgtggttaatttgata
aattaccaggatgatgcagaacttgcaacccgtgctatcccagaactgaccaaattgttg
aatgacgaggaccaggtggtggtgaacaaagctgcagtcatggtgcatcagttgtccaaa
aaagaagcttcccgtcatgctatcatgcgttcccctcaaatggtatctgccattgtgcgt
actatgcagaatacaaatgatgtggaaacagcccgttgtaccgcaggtacacttcacaac
ctttctcatcatcgtgaaggcttgttggcaatcttcaaatcaggaggcattcctgctcta
gttaaaatgcttggttccccagtggattctgtattgttctatgccatcactactctacac
aaccttctgttgcaccaagaaggtgccaaaatggctgtacgtctagctggaggtctacag
aaaatggttgccttgctcaacaagacaaatgtcaaatttttggccattacaacagactgc
cttcagatccttgcttatggtaatcaagagagtaagcttataattttggcaagtggtgga
ccccaggctctggtaaacataatgaggacttatacctatgagaaattactctggaccaca
agcagagtgctgaaggtgctgtcagtttgctctagtaacaaacctgcaattgttgaggct
ggtggaatgcaggccttgggactccaccttacagatccaagccagcgactggttcagaat
tgtctctggactcttagaaatctctcagatgctgcaactaagcaggaagggatggaaggc
cttcttggcacccttgttcagcttttgggctcagatgatatcaatgtggtgacctgtgct
gctggcatcctttccaatcttacttgcaacaactacaagaataaaatgatggtgtgccaa
gtgggtggcattgaggctcttgtgcgcacagttctccgagctggcgacagggaagacatc
actgaacctgctatctgtgcgctccgtcacctcacaagtaggcatcaagaagcagagatg
gcgcaaaatgcagtgcgtcttcattatggacttccagtggtggtcaaactcttgcatcca
ccatctcactggcctcttatcaaggcgactgttggtcttatccgcaatcttgcactctgt
ccagcaaatcatgctccgctccgtgagcaaggtgctattccaagactagtgcagctgctt
gtgagagcccatcaggacacccagcgtcgtacttcaatggggggcacacagcagcaattt
gtggagggtgtgcgtatggaggaaatagttgagggttgcactggagcccttcatatcctg
gctagagatgttcacaatagaattgtcatcagaggtcttaacaccattccactgtttgtg
cagctgctatattctcctattgagaacatccagagagtggctgcaggcgtattgtgtgaa
ttggctcaggacaaagaagcagccgaagcaattgaagcagaaggagcaacagcaccactg
acagaactgcttcactctaggaacgagggtgtggcaacatacgcagctgcagtgttgttt
aggatgtctgaggataaaccacaggattataagaaacggctttcagttgagttgaccagc
tctctcttcaggactgaaccaatggcttggaatgagactgctgatctgggacttgacatc
ggtgcacagggagaacctcttggctatcgcccggatgatcctagctaccgttctttccac
tctggaggatacggtcaggatgccttgggcatggacccaatgatggaacatgaaatgggg
ggccaccacccgggtgctgactacccagttgatgggctgccagatctaggacatgcccag
gaccttatggatgggctgcctccaggtgacagtaatcagttggcctggttcgatactgac
ctgtaa

DBGET integrated database retrieval system