KEGG   Anolis carolinensis (green anole): 100567119
Entry
100567119         CDS       T01608                                 

Gene name
ikbkg
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04210  Apoptosis
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04622  RIG-I-like receptor signaling pathway
acs04623  Cytosolic DNA-sensing pathway
acs04625  C-type lectin receptor signaling pathway
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100567119 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100567119 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100567119 (ikbkg)
   04621 NOD-like receptor signaling pathway
    100567119 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    100567119 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    100567119 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    100567119 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100567119 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100567119 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100567119 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100567119 (ikbkg)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100567119 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 APG6_N Csm1_N Jnk-SapK_ap_N Taxilin DivIC zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 100567119
NCBI-ProteinID: XP_008102141
LinkDB
Position
2
AA seq 569 aa
MMGDDSSLGRDGPLHLPAELAGHEAVQHVLAENRDLKEAIQRSNHMLRERYREFLQFQAS
HKQEKEFLFCKFQEARLLVENLQLERTGLKKKLEKTAQELEQLKRQLAASHPCPSEKEAS
GAQEDQDTVTLTQEENIFAVVPESTQQNRGQLEEELKVLQDANQALQKEKLALQAEICAL
QQATKTTLPVEVRGIKLKENGLQAERPLELESLQGSGDRKSSDGDQAEQLSKKLKEAEDE
NVSLHQQLALAQAELARMASQEQETQQQLQTLNKQLEQFGEDRASVKAQVTSLLGELLES
QTRLETSTKEKKELEERIRGTAEQLHQFEREADARTKQHSVQVDQLRLQVQNLESALRVE
RQSASEEKRKLAQLQVAYHELFREYDSHIKTSLESEKRSKGLDLQVAELSQQLQEAEEAL
VAKQELIDKLKEEAEQHKAIMETVPVLKAQADIYKTDFLAERQAREKLHEQREALLEQLA
QLQRDYEKLKADSEGASRALMEEMRNRHSDVRPPPPLPDYQMGWNGPGMLMAGPRQSFAE
EQPNYCCPKCQYRAPDMDTLQIHVMDCIQ
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgatgggggatgactcttctcttggcagagatggcccccttcacctgccagctgagctg
gctggacatgaagcggtgcagcatgtcctggctgagaacagagacctcaaagaagccatc
caacgaagtaaccatatgctgcgggagcgttaccgagagttcctgcaattccaggcttcc
cacaaacaggagaaggaattcctcttttgcaagttccaagaggctcggctgctggtggaa
aatttgcagttagaacggacaggactgaaaaagaagctggagaaaaccgcccaagagctg
gaacaactgaagaggcaactggcagcttctcatccatgtccttcagagaaagaggcctct
ggagcacaagaggaccaagacactgtaacccttactcaagaagagaacatatttgcagtg
gtccctgaatcgacacagcaaaacagggggcagctggaggaagagctaaaggtactccag
gatgccaaccaggctttgcagaaagagaagctggccttgcaagctgagatctgtgcgtta
caacaagccacaaaaaccacattgcctgtagaagtacgtggaataaagcttaaagagaac
gggcttcaagcagaacggcccctggagctggaatccctgcagggatcaggggacagaaaa
agttctgatggggaccaagctgagcagctgtccaagaagctgaaggaagcagaagatgag
aatgtatcacttcatcaacagttggcattagctcaggcggagttggcccgtatggcatct
caagaacaggagacccagcagcagctgcaaacattaaacaagcagttggagcaatttggg
gaggacagggcctcagtaaaggcccaggtgacctccctcctgggggagctgctagaaagc
caaacccgcttggaaacatccacgaaggaaaaaaaagagctagaggagaggatccgtgga
actgctgaacaactccatcagttcgaaagggaggccgatgcccgcaccaaacagcacagt
gtgcaggtggatcagttgcggctgcaggtgcaaaacctagaaagtgccctgcgagtggaa
cggcagagtgcctcagaggaaaagagaaaactagcccagttgcaagtggcctatcacgag
ctcttccgggaatatgattctcatatcaaaaccagcctggaaagtgagaaacggagcaag
ggcttggatctgcaagtcgctgaactgtctcaacaacttcaagaggctgaagaggctctg
gtagccaagcaggagctgattgacaagctgaaagaggaggctgaacaacacaaagccatc
atggaaacggttcctgttctcaaagcacaagctgatatttataagacggacttcctggct
gagcgtcaggctcgtgaaaaactacatgaacagcgagaggccctgctggagcagcttgcc
caattgcaaagagattatgagaaactgaaagcagactctgagggggccagccgggctctt
atggaagagatgaggaatcgccattccgatgtgcgtccacctcctccattgccagattac
cagatgggatggaacggaccaggaatgttgatggcaggtccaagacaaagctttgctgaa
gagcagcctaactactgttgtcctaaatgccagtacagagctccagacatggacacacta
caaatccatgtcatggactgcattcagtga

DBGET integrated database retrieval system