KEGG   Anolis carolinensis (green anole): 100567197
Entry
100567197         CDS       T01608                                 

Gene name
mdm4
Definition
(RefSeq) MDM4, p53 regulator
  KO
K10127  protein Mdm4
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100567197 (mdm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acs04121]
    100567197 (mdm4)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100567197 (mdm4)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB
Other DBs
NCBI-GeneID: 100567197
NCBI-ProteinID: XP_003220455
Ensembl: ENSACAG00000007350
LinkDB
Position
4
AA seq 474 aa
MTSSTSAQFPLHEKACRTSSERITQVRPKLPLLRILQTAGAQGETFTLKQIIHYLGEYIV
LKQLYDKEEQHMVYCEGDQLGDLLGRESFSVRDPSPVYDMLKRNVTPASVTDAAQTHALA
KDQSVDNPSQDQLKQSSTERSSSIEYKEETSIWYTSKSGCIEDTDNPSKEQTSLDSVLEE
WDVPGLPWWFLGNLRNNYKSRSNGSTDIQTSQDVDTAVVSDTTDDLWFLSEAVSEQLGVT
VPMKTIDCEHANEDGKENNKMVSEVTSSDDFEDSQSLSDDTDNDIAPEDGWQCTKCKKFN
SPIKRYCLRCWALRKDWFFDCPKLKHSVSTSNIASLQSTDEAEGMDVPDCRRTVSAPVVR
PKDLCSSDVTCSSSPKSSMDSLDVSQLCEQRKPVLQLGKRKEKEEEEAQSLETCKELLKP
CPLCRKRPRNGNIVHGKTAHLVACFPCARMLKKTRSPCPLCKKQIQVVIKTYIS
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgacatcttccacctctgcacaatttccattacacgagaaagcttgcagaacatcatct
gaaagaatcacacaggtaagacccaagctgccgcttttgaggatattgcaaactgcaggg
gctcagggtgaaacttttacattaaagcagatcatacattaccttggagaatatattgtg
ctgaaacagctgtatgacaaagaagaacaacatatggtttattgtgaaggagaccaatta
ggggatcttctgggccgtgaaagcttctctgtaagagatccaagcccggtgtatgatatg
ctgaaaaggaatgtgacacctgcttctgtcacagatgctgcacagacacatgctctcgca
aaggatcagagtgtggataatccaagccaagatcaactgaagcagagtagcacagagaga
agttctagcattgaatataaagaggaaacatccatctggtatacatcaaaatctggctgc
atagaagatacagataacccatcaaaagaacagacttcactggatagtgtgcttgaagag
tgggatgtacctggacttccatggtggtttttggggaatctgagaaacaactacaagtcc
agaagtaatggttctacagatatacaaactagtcaggatgtagatactgctgttgtttca
gatacaacggatgacttatggtttctcagtgaagctgtttcagagcagttaggtgtcaca
gtgccaatgaagacaattgattgtgaacacgcaaatgaagatggaaaagagaataacaaa
atggtaagtgaagttacatcttcagatgactttgaagattcacaatccttaagtgatgac
acagataacgatattgcccctgaggatggttggcaatgcaccaaatgcaagaagttcaac
tcccccatcaaacgatactgcttacgttgctgggccttaaggaaagactggttctttgac
tgccctaaactaaaacattctgtctccacatccaacattgcttcactgcaaagtacagac
gaggcagaagggatggatgtcccagactgccgaagaacagtatcagctccagttgtacgc
cctaaagacctgtgtagttcagacgttacatgtagctcaagccctaaaagctccatggat
tctttagatgtatcacagttgtgtgaacaaagaaagcctgtgctgcagttgggtaagcgg
aaagaaaaggaagaggaagaagcgcagtcccttgagacttgcaaagaattgctgaaacct
tgccctttgtgccggaagaggccacgaaatgggaatattgtccatggaaagactgctcat
cttgtggcctgttttccatgtgccagaatgttaaaaaagacacgatcaccttgtcctctg
tgtaagaagcagattcaagttgtgatcaagacttacatatcatag

DBGET integrated database retrieval system