KEGG   Anolis carolinensis (green anole): 100567308Help
Entry
100567308         CDS       T01608                                 

Gene name
hsp90ab1
Definition
(RefSeq) heat shock protein 90 alpha family class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04141  Protein processing in endoplasmic reticulum
acs04217  Necroptosis
acs04621  NOD-like receptor signaling pathway
acs04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100567308 (hsp90ab1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100567308 (hsp90ab1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100567308 (hsp90ab1)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100567308 (hsp90ab1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100567308 (hsp90ab1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:acs03110]
    100567308 (hsp90ab1)
   04131 Membrane trafficking [BR:acs04131]
    100567308 (hsp90ab1)
   03051 Proteasome [BR:acs03051]
    100567308 (hsp90ab1)
   03029 Mitochondrial biogenesis [BR:acs03029]
    100567308 (hsp90ab1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100567308 (hsp90ab1)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100567308 (hsp90ab1)
Chaperones and folding catalysts [BR:acs03110]
 Heat shock proteins
  HSP90
   100567308 (hsp90ab1)
Membrane trafficking [BR:acs04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100567308 (hsp90ab1)
Proteasome [BR:acs03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100567308 (hsp90ab1)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100567308 (hsp90ab1)
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100567308 (hsp90ab1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12 DUF1198
Motif
Other DBs
NCBI-GeneID: 100567308
NCBI-ProteinID: XP_003215948
Ensembl: ENSACAG00000014791
LinkDB All DBs
Position
1
AA seq 701 aa AA seqDB search
MSLIINTFYSNKEIFMREIISNASDALDKIRYESLTDPSKLESGKELKIDIIPNSHDRTL
TLLDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVV
VITKHNDDEQYAWESSAGGSFTVRTDHGEPIGRGTKVILYLKEDQTEYLEERRIKEVVKK
HSQFIGYPITLYVEKEREKEISDDEAEEEKTEKEEEEAAKEEEKPKIEDVGSDEEEEGGK
AKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVE
GQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSE
DLPLNISREMLQQSKILKVIRKNIVKKCLELFAELAEDKENYKKFYEAFSKNLKLGIHED
STNRKRLSELLRYHTSHSGDEMNSLSEYVSRMKDNQKSIYYITGESKEQVANSAFVERVR
KRGFEVVYMTEPIDEYSVQQLKEFDGKSLVSVTKEGLELPEDEDEKKKMEESKAKFENLC
KLMKEILEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKK
HLEINPDHPIVETLRQKAEVDKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMI
KLGLGIDEDEVAAEEPAAAAASEEIPPLEGDEDASRMEEVD
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgatcatcaacaccttctactccaacaaagaaatatttatgcgggagataatt
tctaatgcctctgatgccctggacaagatccgctatgagagtttgactgatccatccaag
ctggaaagtggcaaggaactgaaaatagacataatccccaattcgcatgaccgtaccctc
acattgctggacactggcattggcatgactaaggcagaccttatcaacaacttgggcacc
attgctaagtctggcaccaaggcattcatggaagccttgcaggctggtgcagatatctct
atgattgggcagtttggtgtgggcttttactctgcataccttgtggctgagaaggttgtg
gtcatcaccaaacacaatgatgatgaacagtatgcctgggaatcatcagcgggaggctcc
ttcactgttcgaacggatcatggcgagcccattggccgtggcaccaaagtgatcttgtat
ctgaaggaggaccagacggagtacctagaggaacgccggattaaagaagtggtgaagaag
cactcacagttcatcggctaccccatcactctctatgtggagaaggagcgtgagaaggaa
atcagtgacgacgaggcagaggaggaaaagacagaaaaggaagaagaagaggcagccaag
gaagaagagaaacccaagattgaagatgtgggctcagatgaggaagaggaagggggcaaa
gccaaaaagaagactaagaaaatcaaggagaagtacattgaccaggaggagctcaacaag
accaagcccatctggacccgcaacccagatgatatcactcaagaagaatatggagagttt
tacaagagccttacaaatgattgggaggaccatctggctgtcaagcatttttctgtggag
gggcagctggaattccgcgctcttcttttcatcccacgccgggccccgtttgacctcttc
gagaacaagaagaagaagaacaacatcaagctctatgtcaggcgtgtcttcattatggac
agctgcgacgaactcatcccagaatacttgaatttcatccggggcgtggtggactcagag
gacctgcctctgaacatctcccgtgagatgctgcagcagagcaaaatcctcaaagtgatc
cgcaagaacattgtcaagaaatgcctggaactctttgctgagttggcagaagacaaagag
aactacaagaagttctatgaagccttctccaaaaaccttaagctggggatccatgaggac
tctacaaaccggaaacgcctctcagagctgttgcgctaccacacttctcactccggagat
gagatgaactccctctcagagtatgtgtcccgcatgaaggacaatcagaagagcatctat
tacatcacaggtgagagcaaggagcaggtagccaactctgcttttgtggagcgtgtgagg
aaacgtggtttcgaagtggtgtacatgacagagcccattgatgagtacagtgttcaacaa
cttaaggaatttgatggaaagagcttggtgtctgtcaccaaggaaggtctggagctgccc
gaagatgaggatgagaagaagaaaatggaggagagcaaagccaaatttgaaaatctttgc
aaactcatgaaggaaatcctggagaaaaaggttgagaaggtcacagtctcaaatcggctg
gtctcttccccctgctgcattgttaccagcacctatggctggacagccaacatggagcgc
atcatgaaggcccaggccttgcgtgacaactccaccatgggctacatgatggcgaagaag
cacttggagatcaatcctgaccaccccattgtagaaactctgcgacagaaggctgaggtg
gacaagaacgacaaggccgtcaaggacctggttgtactactcttcgagacagcgctgctt
tcttctggcttctccctagaggacccacagactcactccaaccgcatctataggatgatc
aaactggggctagggattgatgaagatgaagttgctgctgaggagcctgctgctgctgct
gcctctgaagagatccctccgctagagggagacgaggacgcttcacgcatggaggaggtg
gattaa

DBGET integrated database retrieval system