KEGG   Anolis carolinensis (green anole): 100567718
Entry
100567718         CDS       T01608                                 

Gene name
jun
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04137  Mitophagy - animal
acs04210  Apoptosis
acs04310  Wnt signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04912  GnRH signaling pathway
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100567718 (jun)
   04012 ErbB signaling pathway
    100567718 (jun)
   04310 Wnt signaling pathway
    100567718 (jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100567718 (jun)
  09143 Cell growth and death
   04210 Apoptosis
    100567718 (jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100567718 (jun)
   04530 Tight junction
    100567718 (jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100567718 (jun)
   04621 NOD-like receptor signaling pathway
    100567718 (jun)
   04625 C-type lectin receptor signaling pathway
    100567718 (jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100567718 (jun)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100567718 (jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acs03000]
    100567718 (jun)
Transcription factors [BR:acs03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100567718 (jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch DUF3450 Jnk-SapK_ap_N Fib_alpha TEX13
Other DBs
NCBI-GeneID: 100567718
NCBI-ProteinID: XP_008107582
Ensembl: ENSACAG00000007057
UniProt: G1KG27
LinkDB
Position
4
AA seq 314 aa
MTAKMEPTFYDDAINATFVQPESGTYGYNNPKVLKQSMTLNLADPSSNLKPHLRNKNADL
LTSPDVGLLKLASPELERLIIQSGNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHNQNTMPSVTSAAQPANSGMAPVSSMAGNNGFSASLHSEPPVYANLSNFNPSTLSTAPN
YPASNLGYPPQHHLNPPMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAER
KRMRNRIAASKCRKRKLERIARLEDKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVN
SGCQLMLTQQLQTF
NT seq 945 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaacctacattctacgacgatgccatcaacgccaccttcgtccag
ccagaaagtggcacttatggatacaacaaccccaaagtcctgaagcagagcatgacgctc
aatctggccgacccgtccagcaacctcaagccacacctgaggaacaagaacgccgacctc
ctgacctctcccgacgtgggcctcctcaagctggcttctcctgagcttgagaggctgatc
atccagtctggcaatgggctgatcaccaccactcccaccccgacccagttcctgtgcccc
aaaaatgtcaccgacgaacaagaagggtttgcggaaggctttgtcagggctctcgcagag
ctacacaatcaaaacaccatgccaagtgttacctctgctgcccagccggccaactctggc
atggccccagtctcttccatggctgggaacaatggcttcagtgccagcttgcacagcgag
cctcctgtctatgccaacctcagcaatttcaaccccagcaccctcagcacggcacctaac
tatcccgccagcaacctgggctaccctccgcaacatcatctgaaccctccaatgccggtg
cagcatccccgcctccaggctctgaaagaagagcctcagactgtcccagaaatgcctggg
gagactcctcccctgtcaccaattgacatggagtcccaggagaggatcaaggcggagagg
aagcgcatgagaaaccgcattgccgcctccaagtgccggaaaagaaagttggagcggatt
gccaggttggaagacaaagtgaaaactttgaaagcccagaactcggaacttgcgtccacg
gccaacatgctgcgagagcaggttgcgcagctgaaacagaaggtcatgaatcacgtcaac
agtgggtgccagctcatgctcacacagcagttgcaaactttttga

DBGET integrated database retrieval system