KEGG   Anolis carolinensis (green anole): 100567913Help
Entry
100567913         CDS       T01608                                 

Gene name
cacna1e
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100567913 (cacna1e)
   04020 Calcium signaling pathway
    100567913 (cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acs04040]
    100567913 (cacna1e)
Ion channels [BR:acs04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100567913 (cacna1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 100567913
NCBI-ProteinID: XP_008107102
Ensembl: ENSACAG00000000106
LinkDB All DBs
Position
4
AA seq 2438 aa AA seqDB search
MMLSLSTCSISTHMLSEVGFPVDGAPELENDPQRCVLALPEEEAWRKHRLGPMQSTQSCN
LLDPETLSDALVSRTASFDALYELRSQDMESSLGLDGSSTFDVGQSQLLPVSPEVIKRRR
GGLIEQRDIVKAHEAHKIQSTPQARRKEWEMARFGEAMAGRVGSGDGATEQNRNRQGAPA
PPGGTPVQAYKQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWP
PFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFV
FHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQI
VLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYVNNSGELQELDPPHPCG
VQGCPAGYECRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWL
YFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDK
AEEVMLAEENKNSGTSALEVLRRATIKRNRTEVMNRDSSDERVDISSVGTPLARASIKSA
KLDGANYFRHKERLLRISVRHMVKSQVFYWLVLSIVALNTACVAIVHHNQPPWLTHLLYY
AEFIFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISV
MRALRLLRIFKVTKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFN
FMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSSIYFIVLTLFG
NYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDR
RRRHHMSMWEPRSSNLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINNEDPPLLNPHAS
IFRRRKLLENSGPEKNEEGQGDRSERANGEGQDQQIPGSNPCPSIQENQKSPSSRPKKEW
EEWHHKSFHGNCDLIEPEGGGSGGFEERARLRQSQRRSRHRRVRTEAKEHRAASQEMAPE
EAVPAEGEQNVEQKKNEEEKEALIEKDQGTGEEQKITNEVSVNDAAFHVATHETSPSEGH
LDLNQSKDVSPVEQDGNSPDTSEQALLGDLPMESGRTISRSEPDLSSITTNVEKATESAT
IMIDVQDSAVVQISNKTDGEASPLKEPETKEEEEVEVEKKKPKKKKSATGKPMVPHSSMF
IFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFT
GVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALMAFALANALGTNKGRDIKTI
KSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGK
FFYCTDSSKDTQKDCIGNYVDHEKNLMEVKCRQWKRHEFHYDNIIWALLTLFTVSTGEGW
PQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMM
EECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTIV
LMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSI
TEIILTDSKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLI
AMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLG
GKGCESDTTATSGQNGSEQCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSS
ILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMN
MPVAEDNTVHFTSTLMALIRTALDIKIAKGGAEWQQLDSELQKEILTIWPHLSQKQLDVL
VPMPKTTDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISN
AKALPYLQQETFSGLSSRSGFPSLSPLSPQEIFQLACMDPTHGEYQEQQSLEPEVREFKR
VQPSNCGSYLPVDTQERAVSGRASSMPRLTVDPQVVTDPGSMRRSFSTIRDKRTNTSWLD
EFSMEKSSENTYKSRRRSYHSALYLSSRRLNTDSGHRSDTHRSGGRERGRSKERKHLLSP
DISRCNSEERSPQADGDSPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRS
RRQLPPVPPKPRPLISYAAMMQHCGDTSPNPDDSEGGSPLLSGTLETNNPCLTESSSSPT
GKQSLLSTPQHYISEPYLMLQDDSHASDCGEEETLTFEAAVATSLGRSNTIASGPRSRHS
WQMPNGHYRRRRRGASSQGVMFGAGIDVLSDTEEDDKC
NT seq 7317 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcagcctcagcacctgttccatcagcactcacatgctctctgaggtaggtttc
cctgtggatggagcccctgaactggaaaatgacccccagagatgtgtgctggccctgcca
gaagaagaggcatggcggaagcaccggcttggaccgatgcagtctactcagtcttgcaac
ttgcttgacccagagaccttgagtgatgcccttgtctcacggactgccagctttgatgcc
ctctatgagctgcgttcacaggacatggaatccagtttgggcttggatggcagcagcaca
tttgacgtcgggcagagccagcttctccctgtgagccctgaagtcatcaagcgccggcga
gggggcctgattgaacagcgggatattgttaaagcgcatgaagctcataagatacagagc
acaccacaagcaagacggaaggagtgggaaatggctcgttttggtgaggcgatggctggc
agggtgggatccggtgatggagccaccgaacagaacaggaaccgtcagggagcccctgca
cccccaggaggaaccccggtacaagcgtacaagcaaaccaaagcccaacgggccaggacg
atggcactgtacaaccccatacctgtccgacagaactgcttcacagtcaacagatctctc
ttcatctttggggaagacaatattgtcaggaaatacgccaagaagcttatcgactggcct
ccctttgaatacatgattctggcaaccatcattgcgaactgcatcgttctggccctggaa
cagcatctccccgaggatgataagacacctatgtctcggcgattagagaagacagaacct
tatttcattgggatcttttgctttgaagctggcattaaaattgtggctttgggatttgtt
ttccataagggctcctacctgcggaatggatggaatgtaatggatttcatcgtcgttctg
agcggaattcttgctacagcagggacacatttcaacacccatgtggacctacggactctg
cgggcagtgagggttctcagacccttgaagctcgtctcaggcattcctagtttgcagatt
gtactcaaatccatcatgaaggcaatggtgcctcttctccagataggcctgctccttttc
ttcgctattctgatgtttgccatcattggcctggaattctatagtgggaagctgcaccgg
gcctgttatgtgaacaattcaggtgaattacaagagctggacccacctcatccttgtggg
gtgcaaggatgccctgcaggttacgagtgcagagactggattggtcccaacgatgggatc
actcagtttgacaacattctctttgctgtgttgactgtcttccagtgcattaccatggaa
ggatggactacagtgctatacaataccaatgatgccttaggagccacctggaactggctg
tacttcatcccactcatcatcattggatcattctttgttctcaaccttgtcctgggagtg
ctttctggggaatttgccaaagaaagagagcgagtggaaaatcgtcgggctttcatgaaa
ctgaggagacagcagcagattgagcgggaactgaatggctaccgagcatggatagataaa
gcagaagaagtaatgctggctgaagagaacaaaaattctggcacatcagctttagaagtt
ctcaggagagcaaccattaaaagaaaccggacagaagtcatgaatcgtgactccagtgat
gagcgtgtggatatctcctcagtgggtaccccacttgcccgggccagcatcaagagtgct
aaattggatggagcgaattacttccgacacaaggaacgcctcctgcgcatctccgtccgt
cacatggtgaaatcccaggtgttctattggctcgtcttgagtatagtggccctcaacact
gcctgcgtggccattgtccatcacaaccaacctccatggctcacacatctcctctactat
gcagaatttatttttctggggctcttcctcctagagatgtccttgaagatgtatggaatg
ggtccacgtctttacttccattcttccttcaactgctttgactgtggggtcaccgtgggg
agcatctttgaagtagtttgggccatcttcagacctggcacttcttttgggattagtgtt
atgcgagccttgagacttctgaggatattcaaagtaacaaagtattgggcttccttgagg
aatttggtggtctcactgatgagttctatgaagtctattatcagcctcctcttcctcctt
ttcctcttcattgtagtctttgccctgcttgggatgcagctgtttggtggaagatttaat
tttatggatggaactccttctgcaaactttgataccttccctgcagccatcatgactgtt
ttccagatcttgacaggtgaagactggaatgaagtgatgtacaatgggatccgctcccaa
ggtggtgtcagctcaggaatgtggtcatccatctatttcattgtactcactctgtttgga
aactatactctgcttaatgtcttcttggccattgctgtggacaacttagccaatgcacag
gagctgacaaaggatgagcaggaagaagaagaagcatttaatcaaaagcacgcactgcag
aaagccaaggaagtcagtcctatgtctgctcccaacatgcctgctatagaaagagacaga
aggaggagacaccacatgtcgatgtgggaaccacgcagcagcaatctgagggagaggaga
aggcggcatcacatgtctgtctgggaacagcggaccagccagctccgccgacacatgcag
atgtccagccaagagggcatcaacaatgaggatcctcctttgctcaatcctcatgccagt
atttttcggaggaggaagctactggaaaattctggccctgaaaagaatgaggagggtcaa
ggggacaggtcagagcgggcaaacggagaaggccaggaccaacagattcctggttccaat
ccctgcccaagcattcaggaaaaccagaagagcccatcttctcgacccaaaaaggaatgg
gaagaatggcatcacaaatcatttcatggtaactgtgacctgattgaaccagaaggtgga
ggaagtgggggctttgaggagcgagcccgccttcgacaaagtcagaggcgcagtcggcat
cgtagggtgagaacagaggcaaaggagcatagggcagccagccaggagatggccccagaa
gaagctgttccagcagagggagagcagaatgtggagcagaagaaaaatgaagaagaaaag
gaggccttgattgaaaaggaccaggggactggtgaggagcagaaaataaccaatgaagtc
tcagtaaatgatgctgcctttcatgtggccacccatgaaactagcccctccgaaggccat
cttgatttgaaccaaagcaaggatgtcagtccagtagagcaagatggtaatagcccagac
acaagtgagcaagcactattgggtgacctgccaatggagtcaggccggactatcagcaga
agtgaaccagatctctcctccatcacaaccaatgtggagaaagctaccgagagcgctacc
atcatgattgatgttcaagactctgctgtggtacagattagcaacaagacagatggagag
gccagccctctgaaggaaccggagacaaaggaggaagaggaggtagaagtagaaaagaag
aaaccaaaaaagaagaaatctgcgacaggaaaaccaatggtgccacacagctccatgttc
atattcagcaccacaaacccaatccgaagggcctgccattacattgtcaacctgcgttat
tttgagatgtgcattcttctggtgattgcagcgagcagcattgctttggcagcagaggac
cccgtcttgaccaactcagagaggaataaagtcctgaggtattttgactatgttttcacc
ggtgtgtttacctttgagatggttatcaagatgatagatcagggattgatcctacaagac
ggctcctatttccgagatctctggaacatcttggatttcattgtggttgtcggagcactg
atggcttttgctttggcgaatgctttggggaccaacaagggtcgggacattaaaactatc
aagtctcttcgtgttctgcgagtcttgagaccattgaagaccatcaagaggttgccaaaa
ctcaaggcagtctttgattgcgttgtaacatcactgaagaatgtcttcaacatactaatt
gtctacaagctcttcatgttcatctttgccgtcattgcagtccagctcttcaagggaaaa
ttcttctactgtacagacagctcaaaagatacacagaaagattgcataggcaactacgtg
gaccatgagaaaaatctgatggaagtgaaatgccgtcaatggaagcgccatgaattccac
tacgataatatcatctgggctttgctcaccctcttcactgtctccactggagaaggatgg
ccacaggttttgcagcattcagtggatgtgaccgaggaagaccgtggccccagccgcagc
aaccgcatggaaatgtccattttttatgtagtgtattttgtagtttttccttttttcttc
gttaacatctttgtggctctcatcatcatcactttccaggagcaaggagacaaaatgatg
gaggaatgcagtcttgaaaaaaatgagagagcgtgcattgactttgctattagtgctaaa
cccctcacccgctatatgcctcaaaatcgccacacttttcaataccgggtctggcatttt
gtagtctctccatcatttgaatataccatcatggctatgatagcactaaatactatagtt
ctaatgatgaagtactattctgctccctacacctatgaactggctttgaagtatctgaac
attgcttttaccatggttttctcactagaatgtgtcctgaaaattatcgcctttggcttt
ctgaattatttccgtgacacctggaacatctttgatttcattactgtaattggtagtatt
acagagattatcttgacggatagcaagctggtaaatacaagcagcttcaacatgagcttt
ctaaaattgttccgagctgcccgtctcatcaaactacttcgccagggttacaccatccga
attttgctgtggacttttgtacagtcgttcaaggcccttccttatgtctgtctcctgatt
gcgatgctcttcttcatttatgcaatcattggcatgcaggtttttgggaatatcaaatta
gatgaagaaagtcacataaaccgtcacaacaactttcgcagcttcctaggttctctcatg
cttctcttcaggagtgctacaggggaggcatggcaggagatcatgctttcatgcctagga
ggtaaaggatgtgagtcagacaccacagcaacatctggacaaaatgggagtgagcagtgt
ggcacagatctggcatatgtttactttgtctccttcatcttcttctgctcttttttgatg
ctcaatctctttgtggctgtcatcatggacaattttgaatacctgactcgagattcctcc
atcttaggaccacaccaccttgatgaatttgtacggatctgggcagagtatgacagggct
gcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtccccacca
ctaggcctcggcaagagatgtccctccaaagttgcttataagagactggtcctgatgaat
atgcctgtggccgaggacaacacagtccatttcacttccactttgatggccttgattcga
acagctctggatattaagattgcaaaaggcggagcagaatggcagcagctagactcagag
ctccagaaggagattctgaccatctggcctcacctttcacagaagcagctagatgtattg
gtacccatgccaaaaactacagacttgacagttgggaaaatctacgcagccatgatgatc
atggactattataagcagagtaaagctaagaaacaaaggcagcagctggaagaacagaaa
aatgccccaatgttccagcgcatggaaccttcctctcttcctcaggagataatttctaat
gccaaagctttaccttacctccagcaagaaaccttttcaggactgagcagccggagtggg
ttcccctccttgagtcccctctctccccaagagatattccagttggcttgcatggaccca
acccatggggaataccaggaacagcaatctctggagccagaggttagagagtttaaaaga
gtacagccctctaactgtggcagctacctcccggtggatactcaggaacgagcggtatct
gggagggcttcttccatgccacgtctgactgtggatccccaggtggttacagatccaggc
tccatgagacgttcattttctactatccgagacaaacggactaatacctcctggttagat
gaattctccatggaaaaaagcagtgaaaacacctataagtcccgccgtcgcagttaccac
tctgcactgtacctatcttcacggcgcctcaacacagattcaggccatcgatctgacaca
catcggtcaggtggcagagaacgaggccgatccaaggaacggaagcacctcctctctcca
gacatttcccgttgcaactcagaggaaaggagtccacaagcagatggtgattctccagag
cgacggcaatctagatctcccagtgaaggcagatcacagactcccaacagacagggcaca
ggttccttgagtgaaagttcaatcccatccatatctgataccagcacacccaggcggagc
cgccgccagctccctccagtgccgccaaagccccgccccctcatctcctatgctgcaatg
atgcaacattgtggtgacacctccccgaatcctgatgacagcgagggtggctcccctctg
ctttctggcactctggagacaaacaacccttgcttgactgagtcttccagttccccgaca
ggaaagcagagccttctttctacccctcagcactacatctcagagccttacctgatgctt
caggatgactcccatgcttcagactgtggtgaggaggagacgctcacctttgaggctgct
gtggccaccagccttggccgctccaacacaattgcatcaggccctcgctcaaggcacagc
tggcagatgcccaacgggcactaccgaagaaggaggagaggggcatcatcacagggggtg
atgtttggggctggtattgatgtacttagtgatacggaggaagatgacaagtgctag

DBGET integrated database retrieval system