KEGG   Anolis carolinensis (green anole): 103277695
Entry
103277695         CDS       T01608                                 

Gene name
siva1
Definition
(RefSeq) SIVA1 apoptosis inducing factor
  KO
K22744  apoptosis regulatory protein Siva
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    103277695 (siva1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 103277695
NCBI-ProteinID: XP_008101758
Ensembl: ENSACAG00000028749
UniProt: R4GC95
LinkDB
Position
1
AA seq 178 aa
MPKRSCPFGDPAPAQLKTRVRLKELSQGVLGEQYRRAIFEKTKQLLFRGAQTYMENPCIG
STAGACVKAELPEPLTDKPEACSQHKCNGQMLIGLDGKLRQPSAREPALPIGGSKACSSC
VRTVDTNRACAQCHRYICQDCSKLCSSCNAVACFLCSVIESDNVGEQVLCNECSMFKD
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccgaagcgctcttgcccgttcggagacccggccccggcgcagctgaagacccgcgtg
aggctgaaggagttgagccaaggcgtcctgggcgagcagtaccggcgagccatctttgaa
aaaacaaaacagcttctcttccgaggtgcccaaacatatatggagaatccatgcattggg
agcacagcaggcgcatgtgtaaaagcagagttaccagaaccacttacagacaagccagaa
gcttgttctcagcacaaatgcaacggacaaatgttaattggactggatgggaaacttcgg
cagcctagtgcaagagaaccagccctgccgataggagggtctaaggcctgttcctcgtgt
gtgagaacagtggacaccaacagagcttgtgcccaatgccatcggtacatatgccaagat
tgcagcaaactttgcagctcttgtaatgctgttgcttgcttcctttgttcagtcatagaa
tctgataatgttggagaacaagtactttgcaacgagtgctccatgttcaaggactaa

DBGET integrated database retrieval system