KEGG   Anolis carolinensis (green anole): 103280931Help
Entry
103280931         CDS       T01608                                 

Gene name
setd1b
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103280931 (setd1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    103280931 (setd1b)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103280931 (setd1b)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103280931 (setd1b)
   HMT complexes
    COMPASS/SET1 complex
     103280931 (setd1b)
    COMPASS/SET1 complex (yeast)
     103280931 (setd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 103280931
NCBI-ProteinID: XP_008119556
Ensembl: ENSACAG00000011162
LinkDB All DBs
Position
Un
AA seq 2026 aa AA seqDB search
MSFKEIKAGEKGKPGGGGGGGGGGEDHGKKQAPSWINGMESSAQASTSAEKKNHHWKSYK
LIIDPALKKGQHKLYRYDGQHFSIPNSGLAPVDCVRDPRIGRIWTKTKELELAVPKFKID
EFYVGPVPPKQVTFAKLNDNIRENFLADMCKKYGEVEEVEILYNPKNKKHLGIAKVVFAT
VRGAREAVQHLHNTSVMGNIIHVELDTKGEKRMHFYELLVNGLYTPQTLPVENEPEASSP
VNETLQLADTLKRLKDSSLSSVGSSATPNSSTPFSHDTAFSSCRQDTPNSFSQFTPQSQG
TPLTPRLGTPFSQDSAYSSRQTTPAYHFGQDSGYKPRRHETKFTDAYNRRPGHHYVHNSV
GAFRSSEHQFSAFKSHQQETVQYPHTSPLSHSGSSTFKSAFSPYQAPATYPPPEEPPLPQ
TSRDVEYRRPPPPPAEVVVESSSATTVDFVPVKEKPEEPPPLPESKSLNEPTIVATFAQT
PDRSETPGTPTTESEVQHNSLDSRIEMLLKEQRSKLYFLNEHDSDNEIRMEGSPISSSSS
QLSPIPNFGSNSQPSYRAQTPSSRPSSTGLEDISPTPLPDSDDDEPILGTASLIQNARGT
SDASMTPVDQLSRTSKTESSEAKEMLPSNDSPTPEQMEECHQSSGEDMEISDDEMASSPS
TECAKNIVVNTSIGNSAVMGSSIPMPPPGFPPLPPPPPPQTVYPMPPPLPPPPPPTHPAV
TVPPPPLPAPPGVPPHHILPPLPHFHPGMFPVMQMDMISVLGNQWGGMSMSFQMQTQMLS
RLMQGQNTYQYPPFLGNRVQFVNLPPYRHFSMGASVNRGQQWPPLPKFDPSVPPPGYEPK
KEDPHKATVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVK
SGENKDEEKPKPKDRITSCLLENWHKGEGLGYEGIGLGIGLRGAIRLPSFKVKRKEPPEA
ASAGDQKRLRPSTSVDDEDEESERDRDLPDATSDLSKKDAEAVGLRRRPGRPLELDSEGE
EADSAKEEEEESSSEKEPEQEEEVMKSASDKEEEEEEDINEEEEEEDDEEDEEEAETEMS
EKEEYPDSEEDDVRSPVSSRAELESSDESDESSDFGTSSDSDDEDDEDEEEEEEEEEEEE
EEAEEEESYEEQVEDNEGTSLRQEREEAELAEESLLHEPENDDEKETILELFAVDDYMGG
TPLVLGQVPIPEGEEQKEEAGQPEEESGEVPEESLAAEVLIVIERAQEEKLQLSPVCAPV
SVEEPEPNIEPEPEMLDGPKPETQEEENLRPPTSLGLLGDVLPSKTSFFSKHEDSSLYAQ
AKPKLPLTAEEEGRLPRTPGREVPSHGESPLLSMDAVPSCSLPLPCGMSGKEELLLLPDK
FPGQLPMTKPPLEEELPRTPGRDILAKCSHSLSKSQSTDTVPATPGSDAPLTGSSLTLSS
PQVPGSPFSYPSQSPSINSGGIPRTPGRDFTFTPTFPEPGATLPCFLSSKKLSEDEPDEK
VFKEPLSASLMAGVNSVPSPIPFASPPVQSFHAHVELPPNQPVPLTVQPCLFVDSKMSLE
EHSMDTQPLFAPEQTGSSPPLPPPPPSSVLPLKRKPGRPKRSSPLGPLLEPYPSKPLEPP
LLPIPVALTESAVNKELLSSHPEAFYPLKDPEAVTLDFRNDCFHDKVGPEVLSEKLPFKE
LENQWNEDLKEDEAYLKCKRQWRRQKKRPDDLPTIPSPEYSPQRFHFRPRSEFEEMTILY
DIWNGGIDDEDIHFLCITYDHLLQQDNGMDWLNDTLWVYHPSTSFSTAKKKKRDDGMREH
VTGCARSEGYYKIDKKDKLKYLNNSRAFAEEPPADTQGMSIPAQIHVSTRAGSERRSEQR
RLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIR
QVIADMREKRYEDEGIGSSYSSYMFRVDHDTIIDATKCGNFARFINYSLPNCYAKVITVE
SQKKIVIYSKQYINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6081 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcaaagagatcaaggcaggagagaaaggcaagcccggcggaggcggaggaggc
ggaggaggaggagaagaccatggcaagaagcaggctccgagttggatcaacggaatggag
agcagcgcccaagccagcacctccgccgagaagaagaaccaccattggaaaagttacaag
ttgattattgacccggctttgaagaaaggacagcacaaactctatcgatacgatgggcaa
cattttagcattcctaattcgggcctggcccccgtggattgtgtccgagacccccggata
ggacgcatctggaccaaaacgaaggagctggaactggccgtccctaaatttaagattgac
gaattttacgtggggcccgtgcctcccaaacaagtcacctttgccaagctgaacgacaac
attcgcgaaaacttcctggccgacatgtgcaagaagtacggcgaagtggaagaagtggag
atcctctacaaccccaagaacaagaagcacctggggattgccaaagtggtctttgccacg
gtccgaggggcccgggaagcggtccagcacttgcacaacacctccgtcatgggcaacatc
atccacgtggagctggacaccaaaggtgaaaagcgcatgcatttttatgagctccttgtg
aatggactctacactccccagacccttcctgtggagaatgagccagaggcatcctctcct
gtgaatgaaacccttcagttggctgatactctgaaacgcctaaaagacagtagcctttct
tctgtgggatcatcagctacccccaacagtagcaccccattttcccatgatacagccttt
tccagttgtcgacaagatacaccaaactctttcagccagtttacgcctcagtcccaagga
acccctctcacccctcgcctggggaccccgttttcccaagactctgcatactctagtcgc
cagaccacaccggcataccattttggacaggactccgggtataaacccaggagacacgaa
acaaaatttacggatgcctacaatcgacgcccaggccatcactatgtccataactctgtg
ggtgcttttcggagctcagaacatcagttcagtgcattcaagtcccatcagcaagagact
gtgcaatacccccacacctctccattgagccactcgggttcttcgacattcaaatcagcc
ttctccccataccaagccccagcgacatatccccctcctgaagagccaccgcttcctcaa
acgtctagggacgtagagtaccgacggccacctccaccaccagcagaggtggtagttgaa
agtagctcggctaccactgttgattttgtgcctgtgaaggaaaagcctgaggagcctcca
cctttgccggagtccaaaagtcttaatgaaccaacaatagtggcaaccttcgcacagact
ccagataggagcgagactccaggaaccccgaccacggaatctgaagttcaacataacagt
ttagactcacggattgagatgctcttaaaagagcagcgatccaaactctattttctcaat
gagcatgactcagacaatgaaattcgaatggaaggtagtcccatctcctcctcctcttcc
cagctttctccaatcccaaactttggttccaactcccagcccagctacagagcacaaacc
ccgtcttcacgtccttctagcactggcttggaagacatcagcccaacgccgttgcctgat
tcggatgacgatgagccgattcttggaactgcttctctcatccaaaatgcaagaggcaca
tcagatgctagcatgactcctgttgatcagctgagtaggacgtccaaaacagagtcctct
gaggctaaagaaatgctgccttctaatgatagtccaactcctgaacaaatggaagagtgt
catcagtcttcaggggaagacatggagatctccgatgatgaaatggcctcatctccaagc
acagaatgtgccaaaaacattgtggtgaatacctccattggcaactcggctgtgatgggt
tcctcgatccccatgccaccacctggctttccccctttgcctccaccgcctccaccccag
acagtctatccaatgccaccccctctccctccgccgccgccaccgactcaccccgcagtg
actgtcccgcctccgcccctgccggcacccccgggggttccccctcatcatatcttgcct
ccactccctcatttccaccctggaatgttccctgtcatgcaaatggatatgatcagtgtc
ttaggcaaccagtggggtggcatgtcaatgtcctttcaaatgcaaacccagatgttgagc
cgcctgatgcaagggcagaacacgtaccagtacccccctttcttggggaaccgggtgcag
tttgtgaaccttcctccttaccgacatttctccatgggggcatctgtcaaccgggggcaa
cagtggccgcctttgcccaagtttgatccgtctgttcctcccccgggttatgagcccaag
aaggaagacccacacaaagccactgtagacggtgtgctcctggtgattgtgaaggaactg
aaagcaataatgaaaagagacctgaaccggaagatggtggaggtggtggccttcagagca
tttgatgactggtgggacaagaaagagcgcttggcaaaggcatcacttactccagtgaaa
tctggtgaaaataaagacgaggaaaagccaaaaccaaaggatcgcattacgtcttgtctc
ctggagaactggcataaaggcgaaggtctgggttatgaaggtatcggcctaggcattggg
ctacgaggagccatccggttaccatccttcaaggtgaagagaaaggagccacctgaagct
gcctcggctggagaccagaagagactgcggccctctacgtcggtagatgatgaagatgaa
gaatctgaacgcgatcgagacctgcctgacgcgacatcagacctttccaagaaggatgcc
gaagctgtaggcctcaggaggagaccgggcaggccattggaactggatagtgaaggggag
gaggcagactcagccaaggaggaagaggaagaatcttcttcagagaaggagccagagcag
gaggaagaggtgatgaaatcagcatctgacaaggaagaggaggaagaggaagacatcaat
gaagaggaagaagaggaggacgacgaggaggacgaagaagaggctgaaacagaaatgagt
gaaaaagaagagtatccggattctgaagaagacgatgtaagaagcccagtttcctccaga
gcagagcttgaatcatctgatgaaagtgatgagtcctcagactttgggacaagctctgac
tccgatgacgaagatgatgaagatgaagaggaggaggaggaggaggaagaagaggaagag
gaggaggcggaggaggaggaaagctatgaggagcaagtagaagacaacgaagggacatct
ctacggcaagaaagagaagaggctgagctagctgaggagtcgctccttcacgagcctgaa
aacgatgatgaaaaggagacaattctggagttgtttgccgtggatgactacatgggaggg
actcctctggtgctgggacaagttccaatcccagaaggagaggaacagaaggaagaggcc
gggcaaccagaagaggaaagtggggaagtgcctgaggagtctcttgctgcagaagtgctg
atcgttattgagagagcccaggaggaaaaactgcagttgtctccagtgtgtgcaccagtc
tctgtggaggaacctgaaccaaatatcgagcctgagcctgaaatgctggacggtccaaag
ccagagactcaggaagaggagaacctccgtccgccaacctccttggggctccttggagat
gtcttacccagcaagacctcgtttttctccaagcatgaggacagcagtttatacgcccaa
gcgaaacccaagctgcccttgacggctgaggaggaaggtcggcttcctcggactccaggg
agggaagtgccgtctcacggggagtctcccctgctttccatggatgctgtgccatcttgt
tcgctccccctcccctgcgggatgtcaggcaaagaggaactgttgcttcttcctgacaag
ttcccgggtcagttgccgatgaccaaaccaccgctcgaggaagagctgcctcggactccg
ggccgggatattttagccaagtgctcgcacagcctctcgaagtctcagagcactgacacg
gtcccggccacaccgggcagcgacgctcctctcacggggagcagcttgactttaagttct
cctcaagtcccgggcagccccttttcctacccctcccagtcccccagcatcaacagcggt
ggcattcctcggactccggggagggacttcactttcacgcccaccttcccagagcctggt
gctacccttccttgctttttgtccagcaagaagctctctgaggatgaacctgacgagaag
gtctttaaagagcctctgagcgcttctctcatggctggggtgaacagtgtgccctccccc
atcccctttgccagccccccggtccaatctttccatgctcacgttgagttgccgcccaac
cagccagtacctctcactgttcagccttgcttgttcgttgactccaagatgtctctggag
gaacacagcatggacacgcagcccctctttgccccagaacagacggggtcctccccaccc
ctccctcctcccccgccctcctctgtcttgcccctcaaaaggaagccaggccggcccaaa
cggtcctctccgctgggcccgctcttggagccctatcccagcaaacccctcgagccacct
ctccttcccatcccagttgccttgactgaaagtgctgtgaacaaagagttgctgagtagc
cacccggaggctttctatcccctgaaagaccccgaagcagtgaccctggatttccggaac
gactgcttccacgacaaagtgggccctgaggttttatctgagaagcttcccttcaaggag
ttggagaaccagtggaatgaggacctcaaagaggacgaggcttacctgaaatgcaagagg
cagtggaggcggcaaaagaagaggccggacgacctccccacaattccttcccctgagtat
tccccgcaacgatttcactttaggccccggtcagagttcgaggaaatgaccattttgtat
gacatttggaatggagggatcgatgacgaagatatccatttcctttgcattacgtatgat
cacttgttgcagcaagacaatggcatggactggctcaacgataccctgtgggtataccat
ccttcaaccagcttctcgactgcaaagaagaagaaacgagacgatgggatgcgggagcat
gtgacaggctgtgcgcgaagcgaaggctactacaaaatcgacaagaaagataagctaaaa
tacctcaataacagccgtgcatttgctgaggagcctccagccgatacacagggcatgagt
atccctgcccagatccatgtttccacccgggcaggctccgagaggaggtccgagcaacgg
aggctcctgtcatccttcacgggcagttgcgacagcgacttgctcaaattcaaccaactc
aagttccgaaagaaaaagctaaaattttgtaagagtcacattcatgactggggactcttt
gccatggagccgattgctgctgatgagatggtgatagagtacgtgggccaaaacatccgc
caggtaattgccgacatgcgagagaagcgatatgaggatgaaggcattgggagcagctac
agcagctacatgttcagagttgatcatgacacaattatcgatgcaacaaagtgtggaaac
tttgccagatttatcaattattccttgcccaattgctatgctaaagtcatcacggtggaa
tcccaaaagaagattgtcatttactccaagcagtacatcaatgtgaatgaggaaatcact
tatgactacaaattccctatcgaggatgtcaagatcccttgtttgtgcggttcagagaac
tgcagagggaccctgaattaa

DBGET integrated database retrieval system