KEGG   Anolis carolinensis (green anole): 103282300
Entry
103282300         CDS       T01608                                 

Gene name
cdc42
Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04144  Endocytosis
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
acs04912  GnRH signaling pathway
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103282300 (cdc42)
   04370 VEGF signaling pathway
    103282300 (cdc42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103282300 (cdc42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103282300 (cdc42)
   04520 Adherens junction
    103282300 (cdc42)
   04530 Tight junction
    103282300 (cdc42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103282300 (cdc42)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103282300 (cdc42)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103282300 (cdc42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    103282300 (cdc42)
   03036 Chromosome and associated proteins [BR:acs03036]
    103282300 (cdc42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    103282300 (cdc42)
   04031 GTP-binding proteins [BR:acs04031]
    103282300 (cdc42)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    103282300 (cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    103282300 (cdc42)
  Macropinocytosis
   Ras GTPases
    103282300 (cdc42)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103282300 (cdc42)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   103282300 (cdc42)
  Exosomal proteins of breast milk
   103282300 (cdc42)
GTP-binding proteins [BR:acs04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103282300 (cdc42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU Yae1_N
Other DBs
NCBI-GeneID: 103282300
NCBI-ProteinID: XP_008123151
LinkDB
Position
Un
AA seq 225 aa
MFGADEGGKEGRKEGKKEGRKEGKRSILDLATFTMQTIKCVVVGDGAVGKTCLLISYTTN
KFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVS
PSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLA
RDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
NT seq 678 nt   +upstreamnt  +downstreamnt
atgtttggagcggacgagggagggaaggaaggaaggaaggaaggaaagaaagaaggaagg
aaggaaggaaagagatcgatccttgacttggccaccttcaccatgcagaccattaagtgt
gtcgttgtgggcgatggcgccgtcggtaaaacgtgcctcttgatttcttacaccacaaac
aaattcccatccgaatatgtaccaacagtgtttgataactatgctgtaactgtgatgatt
ggcggggagccgtacaccttgggcctctttgacacggcagggcaggaagactacgaccgg
ttgcggcctctcagctacccccagacggacgtcttcctggtctgcttctccgtggtctcg
ccctcctcctttgagaatgtgaaagaaaagtgggtccccgagatcacccaccattgcccc
aagacgcccttcctgctggtggggacgcagatcgacctgcgggacgacccctcgaccatt
gagaagctggccaagaacaagcagaagcccatcacccccgagacggccgagaagctggcc
cgggacctcaaggccgtcaagtacgtggaatgctccgccctcacgcagaaaggcctcaag
aatgtatttgacgaggcgattctggccgccctggagcccccggagccgaagaagagccgc
cgctgcgtcctgctatga

KEGG   Anolis carolinensis (green anole): 107983928
Entry
107983928         CDS       T01608                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04144  Endocytosis
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
acs04912  GnRH signaling pathway
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107983928
   04370 VEGF signaling pathway
    107983928
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107983928
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107983928
   04520 Adherens junction
    107983928
   04530 Tight junction
    107983928
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107983928
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107983928
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107983928
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    107983928
   03036 Chromosome and associated proteins [BR:acs03036]
    107983928
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    107983928
   04031 GTP-binding proteins [BR:acs04031]
    107983928
Membrane trafficking [BR:acs04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107983928
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    107983928
  Macropinocytosis
   Ras GTPases
    107983928
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107983928
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107983928
  Exosomal proteins of breast milk
   107983928
GTP-binding proteins [BR:acs04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107983928
SSDB
Motif
Pfam: Ras Roc Arf PET117
Other DBs
NCBI-GeneID: 107983928
NCBI-ProteinID: XP_016854885
Ensembl: ENSACAG00000012480
LinkDB
Position
Un
AA seq 164 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSTLKHKV
NT seq 491 nt   +upstreamnt  +downstreamnt
atgcagaccattaagtgtgtcgttgtgggcgatggcgccgtcggtaaaacgtgcctcttg
atttcttacaccacaaacaaattcccatccgaatatgtaccaacagtgtttgataactat
gctgtaactgtgatgattggtggggagccgtacaccttgggcctctttgacacggcaggg
caggaagactacgaccggttgcggcctctcagctacccccagacggacgtcttcctggtc
tgcttctccgtggtctcgccctcctcctttgagaatgtgaaagaaaagtgggtccccgag
atcacccaccattgccccaagacgcccttcctgctggtggggacgcagatcgacctgcgg
gacgacccctcgaccattgagaagctggccaagaacaagcagaagcccatcacccccgag
acggccgagaagctggcccgggacctcaaggccgtcaagtacgtggaatgctccaccctc
aaacacaaagt

DBGET integrated database retrieval system