KEGG   Anolis carolinensis (green anole): 103282543
Entry
103282543         CDS       T01608                                 

Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04137  Mitophagy - animal
acs04210  Apoptosis
acs04216  Ferroptosis
acs04218  Cellular senescence
acs04310  Wnt signaling pathway
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103282543
   04310 Wnt signaling pathway
    103282543
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103282543
  09143 Cell growth and death
   04110 Cell cycle
    103282543
   04210 Apoptosis
    103282543
   04216 Ferroptosis
    103282543
   04115 p53 signaling pathway
    103282543
   04218 Cellular senescence
    103282543
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103282543
Transcription factors [BR:acs03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    103282543
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103282543
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    103282543
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 103282543
NCBI-ProteinID: XP_008123458
LinkDB
Position
Un
AA seq 434 aa
MASAASSRGNGRDLEPGDSPAHGCCAVPCLAPGDFHLEAMQRRGGMEDPSLLDSDFGMME
MDPNEVLDLVPMPSSPLSQDTFQTLWSSLLDGKEDQSLLNPDLPYPMSYEEGTSPKAAEG
DYSTLEPVSSVFVSTPIIPSTEDYVGDHGFELAFEQSGTAKSVTCTYSPKLNKLFCQLAK
TCPVHIKVANMPPLGAVIRTMAVYKKSEHVAEVVKRCPHHERSQEFSDSSAPAEHLIRVE
ANQQARYIADPNRRHSVIVPYEPPQVGTDNTTLLLNFMCNSSCMGGMNRRAILAIITLET
LQGDLLGRRCFEVRVCACPGRDRKSEEENALKAAVPKGKSKKVVLPAAPRSNSSENAKRS
AAGSSNHETESGPYILQVRNRKHYRMLKMILEGLELREKQQGEEEEEAEPETRCLPKAPK
RKRLRVKDENPDSD
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggcctccgcggcttcctctcgcggtaacgggcgagacttggagcccggggattccccg
gcacatgggtgctgtgctgtgccttgcttggcgcccggggattttcatttggaagcgatg
cagaggcgaggagggatggaagacccttcgctccttgattccgatttcgggatgatggag
atggacccaaacgaagtcttggacctggtgcccatgccaagctcccctctgagccaggac
accttccaaaccctgtggagctccttactggacggaaaagaggatcagtcccttttgaat
ccggacctgccgtatcccatgtcctatgaggaagggaccagcccgaaggcagcggaaggg
gactacagcaccctcgaacccgtttcatcggtgttcgtctcgacacccatcatcccctcc
accgaggactatgttggtgaccacggcttcgagctggcctttgagcagtcgggcaccgcc
aagtccgtcacctgcacctattctccaaagctcaacaaacttttttgccagctggccaag
acctgccccgtccacatcaaagtggccaacatgccccctttgggtgccgtcatccgcacc
atggccgtctacaagaagtccgaacacgtggccgaagtggtgaagcgctgcccacaccac
gagcgttctcaggagttcagcgacagcagtgcgccagctgagcacctcataagggtggag
gccaatcagcaggccagatacattgccgacccaaacaggcgccacagtgtcatcgtccca
tatgaaccgccacaggtcgggaccgataatactactttattgctcaattttatgtgcaat
agctcttgcatgggaggcatgaaccggcgtgccattttggccatcatcactttggagact
ctgcaaggtgacctcctcggacgccgctgcttcgaggtccgggtttgcgcttgtcccggg
agggaccggaagtcggaggaggagaatgccctgaaagcagccgtccctaaagggaaatcc
aaaaaagttgttcttccagctgctcctcggagcaactcttctgaaaacgctaagagatca
gctgcggggtcttccaaccacgagaccgaaagcggaccctatatcctccaggtccgcaat
cggaaacactaccggatgctgaagatgatcctggaagggcttgaacttcgcgagaagcag
caaggagaggaggaagaggaggcggagccagaaacccgctgcttgccaaaggctccaaaa
cggaagaggctcagagtgaaggacgagaacccagattcggactaa

DBGET integrated database retrieval system