KEGG   Anolis carolinensis (green anole): 107983408Help
Entry
107983408         CDS       T01608                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107983408
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107983408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_core DnaJ_C FixG_C Trs65
Motif
Other DBs
NCBI-GeneID: 107983408
NCBI-ProteinID: XP_016852469
LinkDB All DBs
Position
Un
AA seq 535 aa AA seqDB search
MSQQCDATAKNVNSLDDNGVLVGNWNGDYSRGTNPSAWVGSRDILLKYLKTGYPVLYGQC
WVFAGVVTTVLRCLGIATRTVTNYNSAHDTDVSLTMDIYFDENMKPLEHLNADSVWNFHV
WNDCWMKRPDLPSGFDGWQVVDATPQESSSGIFCCGPCSVEAIKNGLVYMKYDASFCFAE
VNSDKVYWQRQSDGSFKIVYVEEKAIGHLISTKSVGSNQRQDITAIYKHPEGSPEERKAV
ETAAKHGTKAHIYAEKELGQDISVTVDTDEAYTGQDVSLRVTLKNRSSMPRNVSLNLFVA
VMYYTGVTGKRFKEERRQVQVPAGGNQDVPMVISYPEYKKHLVDQGAMKLSISGKVAETG
QVIAKEHTFRLRTPDLTLTLLGPAIIGCETQVQIVFKNPLGVTLTNAIFHMEGSGLSTPN
TMTVGNIGPHQTVTLRQTFTPLRAGQRQLVASLDSPQLSQVHGVLTVNVTQGPPPGPSAS
PASNRGSPARRRGSPAVSRASPAPTRASPAPARGSPANNRGSPAARRTGRTGRPV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacagtgtgatgcgacggctaaaaatgtaaactctctggacgacaacggggtg
ctggtcgggaattggaatggggattactcccggggcaccaacccttcggcttgggtgggc
agccgagacatcctcctcaagtatctcaagactggctaccctgtcctctacggacagtgt
tgggtctttgctggcgttgtgaccacagtgctgcggtgcttgggcattgccacgcggaca
gtcaccaactacaattcggcccatgacacggacgtcagcctcaccatggacatctacttt
gacgagaacatgaagcccctggagcacctcaatgcggactctgtctggaatttccacgtt
tggaacgactgctggatgaagcggcctgatcttccttcgggatttgatggctggcaagtg
gtggacgccactccccaagaatctagtagtggtatcttctgttgtggaccctgctctgtt
gaggccatcaaaaacgggttggtctacatgaaatacgatgcctccttctgttttgctgag
gtgaacagcgacaaggtctactggcagcgccagtcagatgggagtttcaagatcgtctac
gtggaggagaaagccatcggccacttgatcagcaccaaatcggtgggctccaaccagcgt
caggacatcactgccatctacaaacacccagaaggcagcccagaagagcgcaaagcggta
gaaactgccgccaagcacggcaccaaggcccacatctacgccgaaaaggaattgggacag
gatatctcggtgaccgtggacaccgacgaggcctacaccggccaggacgtctccttgcgg
gtcaccctgaagaaccgaagctccatgccgcgcaacgtctcgctcaacctctttgtggcc
gtcatgtactacacgggtgtcacgggcaagcgcttcaaggaggaacgtcggcaagtccag
gtgccggcaggtggaaatcaggatgtcccgatggtgatctcttacccagagtacaagaaa
cacctggtagaccaaggagccatgaagctgagcatctctggaaaagtggccgagactgga
caggtcatcgccaaagagcataccttccgcctccgcacaccggacctcaccctcacgctg
ctgggcccagcaatcattggatgtgagacccaagtccagattgtcttcaagaacccgttg
ggcgtgacgctcaccaatgccatcttccacatggaggggtcggggctttccacccccaac
acaatgaccgtggggaatatcggaccccaccagacagtgacgctgcgacagaccttcacc
ccgctccgcgccggccagcgccaactggttgccagtctggacagcccacagctctcccag
gtccacggggtgctgaccgtcaatgtcacgcagggccctccgcccggaccgtcagcctcc
ccggcatccaaccgaggttctcccgcccgacgccggggctctccagccgtgtccagagcc
tcacccgctccaactagggcttcccctgctccagcccggggctctcctgccaataaccgc
gggtcaccagccgctcggagaaccggacggacagggcgaccggtctga

DBGET integrated database retrieval system