KEGG   Anolis carolinensis (green anole): 107983822Help
Entry
107983822         CDS       T01608                                 

Definition
(RefSeq) eosinophil peroxidase-like
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00983  Drug metabolism - other enzymes
acs04145  Phagosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107983822
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107983822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    107983822
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     107983822
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107983822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 107983822
NCBI-ProteinID: XP_016854564
LinkDB All DBs
Position
Un
AA seq 487 aa AA seqDB search
MHWGQWVDHDMDLAPMTQTSIDNKQVECDTSCNYAPPCFPIKVPPGDPRIKKPGVCMPFI
RTAPACNPTTYVREQLNAITSYLDASMVYGSEEALARSLRNHSNDLGLMALNQDFTDHGL
GLLPFENKTKSLCLYTNKTANIPCFQGGDKRATENLGLTAMHTMFVREHNRLATELKRMN
PHWGGEKLYQEARKIVDAENQVITFRDYLPLVLGNEFYKQLPLYTGYNESVDPTVANVFS
LAFRFGHGSIPPLVPRLDENFKPLAPFFSAPLHLTFCASWRIPMEGGIDPLVRGILADHS
KLMKQNQMMVEELQERLFEQTEHIGLDLASLNLQRGRDHGLPGYNAWRRFCGLSTPSNEA
ELAVVMRNPRLAKKFMDLYGTPENIDIWVGGMAEPFVPYGRVGPLLACLIGNQFRNVRDG
DRFWWERDGVFPPQQRRALSRHSFSRIVCDNTHITEVPRDAFKRNHYPSDFVNCREVQGL
DLSAWRE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcactggggccaatgggtggaccatgacatggacctggcccccatgacccagaccagc
attgacaacaagcaggtcgagtgcgacaccagctgcaattacgccccgccgtgcttcccc
atcaaggtccccccgggagacccccggatcaagaagcccggcgtctgcatgcccttcatc
cggacagccccggcctgcaaccccaccacctacgtccgggagcagctcaacgccatcacc
tcctacctggacgccagcatggtctacggcagcgaggaggccctggcacgcagcctacgc
aaccacagcaacgacctgggcctgatggccctcaaccaggacttcaccgaccacgggctg
ggcctcctccccttcgagaacaagaccaagagcctctgcctctacacaaacaagaccgcc
aacatcccgtgttttcagggaggggacaaacgggccaccgaaaacctgggactgaccgcc
atgcacaccatgtttgtccgggagcataaccggttggccaccgaactgaagaggatgaat
ccgcattggggtggagagaaactgtaccaggaagcccggaagattgtggacgcagagaac
caggtcatcaccttccgagattatttacccctcgtcttgggcaacgagttctacaagcag
ttgccgctctacacaggctacaacgagtctgtggaccccaccgtggccaacgtcttctcc
ttggccttccggttcgggcacggctccatccctcccttggtgccccgcctggacgagaac
ttcaaacccttggctccgttcttctctgctccgcttcacctcaccttctgcgcttcgtgg
aggatacctatggaaggtggcatcgacccacttgtccgcggcatcctggccgaccattcg
aagctgatgaagcagaaccagatgatggtggaggagcttcaggagcggctctttgagcag
acagaacacatcggcctcgacttggcttccttgaacctgcagcggggaagggaccacggc
ttgccagggtacaatgcctggcggcgcttctgcggcctctccactccgagcaatgaggcc
gagcttgcggtcgtgatgcgcaaccccaggctggccaagaagttcatggacctctacggg
acgccagagaacatcgacatctgggtggggggcatggcggagcccttcgtcccctacggc
agggttggccccctcttggcctgcctcatcgggaaccagttccgaaacgtccgggatgga
gacaggttctggtgggagagggacggggtcttccccccgcagcagcgccgggccctcagc
cgccactccttctcccgcatcgtctgcgacaacacgcacatcaccgaggtgccccgcgac
gccttcaagaggaaccactaccccagcgatttcgtcaactgccgggaagtccaagggctc
gacctctcggcgtggagagagtag

DBGET integrated database retrieval system