KEGG   Aspergillus clavatus: ACLA_017900
Entry
ACLA_017900       CDS       T01148                                 

Name
(RefSeq) nonribosomal peptide synthase, putative
  KO
K23667  fumiquinazoline A synthase [EC:6.3.2.-]
Organism
act  Aspergillus clavatus
Pathway
act00998  Biosynthesis of various secondary metabolites - part 2
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
Module
act_M00901  Fumiquinazoline biosynthesis, tryptophan + alanine + anthranilate => fumiquinazoline
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    ACLA_017900
Enzymes [BR:act01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     ACLA_017900
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding
Other DBs
NCBI-GeneID: 4701514
NCBI-ProteinID: XP_001268513
UniProt: A1CN66
LinkDB
AA seq 1113 aa
MFEPRPLTSDSDKVAADVSTTVTEIPLEDTLPQRFVPQNTWMKATPHPVERTVGEVFQSH
VLERPDALAVCACDGTYTYRELDKLSTAMAHELRRQGVTAEVLVALLFEKSKFIVVAMHA
VLKAGGAIMFWDPSLPVDRLRGIFAESGAQMVLSSSTTAGMAAQISSHTIIVDEEHIPAP
SSEALVTTHRPNSALYSVFTSGSTGKPKGFIMEHRALVTCALACGQQLGITKESRTLQFS
SNSFDLATFEHLIPFVFGACICIPSEEERKGDLTRALDKYQVSLAMMTPSVSRLLEPQHL
PLLRTVMLCGEPVSVDDVRRWSAHVHLHNGYSPAEAGCINILNSAMTEAHPNNIGFSTGV
IPWVVDPDNHDRLLPVGEVGELIIQGHAVGRGYFGSPERNKASFIDAPAWVGDFGRESYG
SFYKTGDLVRYEPSDGSMQFLGRKDTQVKLHGQRLELGEVEDQLRRHFAPPHAVIVDLVT
PKNREPNLIAFVSRSQDMTVAANDALQEDHFLVPDEQFVIAAREAQAALRAVLPSYMVPS
EFFLLSHLVMLPSGKTDRRSIRTAAADLAPTARRKYSSMLESAQDRPATDLEELVLALWA
TSLNMPAAEIGVRDNFFNLGGSSLDALRLAASARKMGYSDLPSGVVFKYPTVRSMAGVLE
GTNQQRSIASQPAESVQLEPSLVAQLLSKARIQTDELEHPGFLPMTAFQRKSAGLKCMHI
VLDISGVDHSRLQAAWGLVQERHISLRSVYIPHLDHVYQGFLRRANLMIPIQECDQPAQD
FATAFCDKDAEPVLDGRPWWQLTRINSTQDGSSALIIRTTHAQFDAMTLGVIFNDFMAAM
ENGQLSARERQFSDYMTRRVQHNSSQATVEFWSKFLQGSQMSQPVFTDASAASLPDDHIG
MVYVMRPIQSVSTPPTGITMASAFRAAWAFVLANYTGQHDLVFGEFIEGRTLPLLEDVEN
ITGCTAAETPMRILIPQHAGATVQDLLSHSQEQYIARLPYETSELPDLVPLCAPLWPKQT
SQFSHLLVVENTSAIPPVTVDGRVLEHRWAFHGRLEDVQIQLVPMKDSLHVAILGPEIRL
TNGIADMLVGRLASTLNQFIEKPDALLAEIQWE
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgtttgagccacgccctctgactagtgactccgacaaggtcgcagcagatgtctcgacc
accgtgacggagatccccttggaggatacgctcccccagcggtttgtacctcagaatacc
tggatgaaggcaaccccgcatccggttgagcgcacagttggcgaggtctttcaatcccat
gtcctggagcggccggatgccctcgctgtttgcgcctgcgatggcacttacacttatcga
gagctggacaagctttcgaccgcgatggctcatgagctgcgtcgtcaaggcgtgacggcg
gaggttctcgtggcccttctattcgaaaagtccaagttcatcgtggttgccatgcatgcc
gtcctcaaggccgggggtgcgatcatgttttgggatcccagtcttcccgtggaccgctta
cgcggcatcttcgctgagtccggggcccagatggttctgtcatcaagcacgactgctggg
atggcggcccagatcagctctcacacaatcatcgtggatgaagagcatatcccggcgccg
tcctccgaggctctagtcaccacccaccggcccaatagcgccctctacagcgtcttcacc
tccggttctaccgggaaacccaagggcttcatcatggaacaccgtgcgctggtaacctgc
gccctggcctgtggccagcaattgggtatcacgaaggaatcccgaactctacagttctcc
tccaactcctttgacctggcgacctttgagcacttgattccttttgtgttcggggcatgc
atctgcattccgtccgaggaggagagaaagggtgatctgacccgcgccctcgacaagtat
caagtctcgttggccatgatgacgccctcggtgagccgtctgctggagccacagcacctg
ccgctgctgcggaccgtgatgctgtgcggtgagccggtctcggtggacgatgtgcgccgc
tggtccgcccatgttcatctgcacaatggctacagccctgctgaggctgggtgtatcaac
atcctcaattccgccatgacggaggctcaccccaacaacatcggattttcaaccggtgtg
attccgtgggtggtggacccagacaatcacgatcgcctgctaccggttggggaggttgga
gagctgattatccagggacacgctgtcggacgaggctactttggcagtccggaacggaac
aaggcttcatttatcgatgcgcctgcctgggtcggtgacttcggtcgggaatcatacgga
tccttctacaagactggcgatctcgtgcgctacgagcccagtgatggatcgatgcagttc
ctgggccgtaaagacacgcaggtgaagctgcatggacagcgcctggagctgggagaggtt
gaggaccagctacgacgccatttcgctccaccacacgctgtcatcgtagaccttgtgaca
ccaaagaatcgtgagccgaatcttattgcattcgtgagccgttcgcaggacatgacggtg
gctgcaaatgatgctctccaggaggatcacttcctggtaccggacgagcagtttgttatc
gccgccagagaggcacaggctgctcttcgggctgtgctgccctcatatatggtgccatcg
gaattcttccttctctcccacctcgtcatgctaccgtctggcaagacagaccgccggtcc
attcgcacggctgccgcagaccttgcaccgaccgccaggcgaaagtatagcagtatgctt
gaaagcgctcaagaccggccagcaacggacctcgaggagctcgtgctggcgctgtgggcg
acaagcctgaatatgcctgcagcagagattggtgtgcgggacaatttcttcaaccttggg
gggagctctttggatgcccttcgccttgcggctagtgcacgtaagatgggttatagcgac
ttgccctctggcgtggtgttcaaatacccaacagtgcgctccatggccggcgttctggag
ggaactaatcagcaacggtcgatcgcctcacagccagcagagtccgtccagttagagcca
tcccttgtcgctcagctcttgtccaaagctcgtatacagacggatgagcttgaacacccc
ggcttcctgccgatgaccgccttccaacgaaagtctgccggcttgaaatgcatgcatatc
gttctggatatctcgggcgtcgatcactcccgactgcaggctgcatggggtcttgtccag
gaaagacacatttccctccgttcggtgtatatccctcatctcgaccacgtttatcagggc
tttctgcgccgcgcaaacctcatgattcccatccaagaatgcgaccaaccggcccaagac
tttgcaactgccttctgcgacaaggacgctgagccggtccttgacggtcgtccctggtgg
caattgacgcggatcaatagtactcaagatggtagcagtgcactcatcattcggaccacc
cacgcacaatttgatgccatgacccttggtgtcattttcaatgattttatggcggccatg
gagaacggccagctgtctgcacgggagcgacagttctccgactatatgacccgtcgtgtg
caacacaattcatcccaggcaacagtagagttctggtcgaagttcctgcaaggttcccag
atgagccaacccgtgttcactgatgcctcggcggcttctcttcccgatgaccatatcggc
atggtgtacgtgatgaggccgattcagtccgtctcgactcctccaaccggcatcactatg
gcgtctgcattccgcgcggcgtgggccttcgttcttgccaactatacggggcagcatgat
ctcgtattcggcgagttcatcgaaggccgcacccttcccctgctggaggatgtagagaac
atcaccggttgcaccgcggcagagacgcctatgcggatcctcatccctcagcacgcagga
gccaccgttcaggatctgctttctcactcccaggagcaatatatcgcccgtcttccgtac
gagacctctgagctgccggatctggttcccctctgtgctcctctgtggcccaagcaaaca
agccaattcagtcatctgctcgtagttgagaatacttcggctattccccccgtgactgtg
gatggccgtgtgctggagcaccgatgggccttccatggccgcctggaagacgtgcagatc
cagttggttccgatgaaagactcgttgcatgtagctatcctggggcctgagatccgattg
acaaacggaattgcagatatgttggtgggtaggctggcatcgactctgaaccagttcatt
gagaagcctgatgcgttgcttgcggagattcaatgggaatag

DBGET integrated database retrieval system