KEGG   Aspergillus clavatus: ACLA_019300Help
Entry
ACLA_019300       CDS       T01148                                 

Definition
(RefSeq) alpha-glucosidase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
act  Aspergillus clavatus
Pathway
act00052  Galactose metabolism
act00500  Starch and sucrose metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ACLA_019300
   00500 Starch and sucrose metabolism
    ACLA_019300
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ACLA_019300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 4700931
NCBI-ProteinID: XP_001268651
UniProt: A1CNK4
LinkDB All DBs
AA seq 887 aa AA seqDB search
MLRSLLLLAPMVGAAVAATEPNSPACPGYRATNVREGHNSLTADLTLAGKPCNTYGTDLK
NLKLLVEYQTDERLHVKIYDANEQVYQVPESVVPRVDGKGGSRKKSVLKFNFKANPFSFQ
VKRGREVLFDTSGSNLVFQDQYLNLRTSLPRDPNLYGLGEHTDPLRLTTTNYTRTLWNRD
SYGIPENSNLYGSHPVYYDHRGEDGTHGVFLLNSNGMDIKIDKTKDGKQFLEYNALGGIF
DFYFFNGDTPKDASIEYAKVAGLPAMQSYWSFGFHQCRYGYRDAFEVAEVVQNYTQAKIP
LETMWTDIDYMDRRRVFTLDPDRFPLEKVRELVSYLHKHDQKYIVMVDPAVSVSDNKGFN
DGMEQGVFMKHQNGSLYKGAVWPGVTAYPDWFHPDIQKYWDGQFNDFFSPEKGVDIDGLW
IDMNEAANFCTYPCLDPEGYSIENNLPPAAPPVRPNPRPLPGFPDDFQPPAASKRSVAKG
SKVGLPGRDLLNPRYQIRNDAGLISSKTINTDLIHAGEGYAEYDTHNLYGTMMSSASRQS
MAQRRPAVRPLIITRSTFAGAGTHVGHWLGDNLADWKHYRISIAQMLSFASMFQVPMVGS
DICGFGGDTNEELCARWARLGAFYPFFRNHNEITSIPQEFYRWESVAESARKAIEVRYKL
LDYVYTAFHRQTQTGEPFLQPMFYMYPEDKNTFSNDMQFFYGDSILVSPVHDVSQTSVEA
YFPKDIFYDWNTGDVLRGRGAKVTLSNISVTDIPIHIRGGSIVPIRSESAMTTVELRKKG
FELLIAPGQDGTASGTLYLDDGDSLKQSASLELEFKYRKGNLQIKGKFGMHTDLKINAIT
LLGQTSVPRQVTLSRAGKADSKFDPARQSVTIKTDLSLNESSEIDIN
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatcgctcctgcttcttgcccccatggtgggagccgccgtggctgccaccgaa
ccaaacagccctgcctgccctggatacagagccaccaatgtcagggagggacacaactcc
ttgactgccgatctgacccttgcgggcaagccgtgcaatacctacggcacggatctgaag
aacctgaagcttcttgtggagtaccagactgatgagcgtcttcatgtcaagatctacgac
gccaatgagcaggtttaccaggttcctgagtcggttgtccctcgcgtggacggcaagggc
ggatctcgcaagaagtctgttctgaagttcaacttcaaggcgaaccccttctccttccaa
gtgaaacgaggcagagaagttcttttcgacacttctgggtcgaacctggtcttccaagat
cagtatctgaatctccgcacctcgttgcccagagatcctaatctgtacggtctcggagaa
cacactgatcctcttcgtctgactaccacaaactacacccgtactctttggaaccgtgac
tcgtacggtattcccgagaacagcaatctgtacggtagtcacccagtttattatgaccat
cgtggtgaggatggaacccacggagtcttcctgctgaactccaacggcatggacatcaag
atcgacaagacaaaggatggaaagcagtttttggagtacaatgctcttggaggtatcttt
gacttctacttcttcaatggcgatacacccaaggacgccagcatagaatatgccaaggtt
gctggtctgccggccatgcaaagctactggtcctttggtttccaccaatgtagatacggc
taccgcgatgcttttgaggtcgccgaagtggttcagaactacactcaggccaaaattccc
cttgagaccatgtggaccgacattgactacatggacagaagacgagtgttcactctcgac
cccgacaggtttcccttggagaaggtgcgtgagttagtgtcgtacctgcacaagcacgat
caaaagtacatcgtgatggtcgatcccgctgtcagcgttagcgacaacaaaggtttcaac
gatggtatggagcagggcgtcttcatgaagcaccagaatggtagcctctacaagggtgcc
gtctggcctggtgtcactgcctatcctgactggttccaccctgatatccagaagtactgg
gatggccagttcaacgacttcttcagccccgagaagggtgttgatattgacggtctgtgg
atcgacatgaacgaggccgccaacttctgcacctatccttgcctggatcccgagggctac
tctatcgagaacaaccttccccctgccgccccgccagttcggcccaaccctcgccccctg
cccggcttccccgatgatttccagcctcctgccgcctccaaacgctccgtcgccaagggc
tccaaggtcggactgcctggccgtgacctgctcaatcctcgctatcagattcgcaacgat
gctggcctcatcagcagcaagactataaatactgatctcatccacgctggcgagggctat
gccgagtatgatacccacaacttgtatggcaccatgatgagttccgcttctcgccagtcc
atggcgcaacgtcgcccagcggtgcgtcctctgatcattactcgcagcaccttcgctggt
gctggtacccatgttggacactggctgggtgacaacctcgcggactggaagcattaccgc
atctccatcgctcagatgctttcgttcgcttcgatgttccaggttcccatggtcggctcg
gatatttgtggatttggcggtgacacgaacgaggagctttgcgctcgttgggcccgtctc
ggtgccttctaccccttcttccgtaaccacaacgagatcacttcgatccctcaggagttc
tatcgctgggagtccgttgcggaatccgctcgcaaggcgattgaagtccgctacaagctc
ctcgactatgtctacactgccttccaccgtcagacccagaccggcgagccgttcctgcag
cccatgttctacatgtaccccgaagacaagaacaccttctcgaacgacatgcagttcttc
tacggtgattccatcctggtcagccctgtccacgacgtcagccagacctcggtcgaggcg
tacttccccaaggatatcttctacgactggaacactggcgatgttctgcgcggccgtggt
gccaaggtcaccctcagcaacatcagcgtgaccgacatccccatccacatccgtggtggc
agcatcgtccccatccgctcggagtcggctatgaccaccgttgagctgcgcaagaagggc
ttcgagcttctcatcgctcctggacaggacggcaccgcctcgggcaccctgtacctggat
gacggcgattctctgaagcagtccgcctccctcgagctggagttcaagtaccgcaagggc
aacctccagatcaagggcaagttcggcatgcacactgatctgaagatcaatgctattacc
ctgcttggccagacctctgtccctcgccaggtgactctttcgcgtgctggcaaggccgac
tctaagttcgaccctgcccgccaaagcgtgaccatcaagaccgacttgtctcttaacgag
tcttcggagatcgacatcaactaa

DBGET integrated database retrieval system