KEGG   Aspergillus clavatus: ACLA_027530Help
Entry
ACLA_027530       CDS       T01148                                 

Definition
(RefSeq) fructosamine kinase, putative
Organism
act  Aspergillus clavatus
SSDB OrthologParalogGFIT
Motif
Pfam: Fructosamin_kin APH GST_N_3 GST_N_2 GST_N GST_C_2 SUZ
Motif
Other DBs
NCBI-GeneID: 4701827
NCBI-ProteinID: XP_001269457
UniProt: A1CQW0
LinkDB All DBs
AA seq 546 aa AA seqDB search
MAPVPASILRALSLPDASKASLSTTGLGSGFTSTGAIHATIASADGTSEEERRYFVKTSA
DGTAAEEMFRGEYESLNAIAHAVPGLCPRALAWGPLDEHSKANSNPTSKSFFLVTEFLEL
GGGGGGRHTGPSLAQRLAQLHSTPAPPDPATGRRRFGFPVPTFCGDSRQLNRWRDSWAEF
YAEERLLMILERAERRHGPDGGLRALVERTAGTVVPALLGEGHLGYARDGKGEGIVPVVV
HGDLWSGNAGRGRIVGTGSLRGRGRGRGRGRAGDEEEEEEVVVGDVVYDPSACYAHREYE
LGIMRMFGGFGAPFFEAYHRIVPKTEPVEEYDDRVRLYELYHHLNHHAIFGAGYRSGAVS
IMEKLLKKSTPYHNEQSFLALNPRGLVPTLGVHAGEDDKAIKPLYESNVIREYLKDAYPD
HQPRLLPSDSYEKARARILMDFVSSRRLPKDQLSFPDLALAPWAVRLWAFDGLKTGGLGI
PAEGQEGEDKAVWQRWRKWLRAVEEREGVKATTSEKGHYLPIYTRYAENTAQSELAKATR
AGTGVP
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggccccagtccctgcctctatactacgagctctctccctccccgatgcctccaaagcc
agcctctcgaccaccggcctcggctccggcttcaccagcacaggagcaatccacgccacg
atagcgtccgccgacggcacaagcgaggaagaacgccgctacttcgtcaagacgtccgcc
gacggcacagcagcggaggagatgttccgcggggaatacgagtcgctcaacgcgatcgcg
cacgccgtcccggggctctgtccccgcgcactagcctggggccctctcgacgagcacagc
aaagccaactccaaccccacaagcaagagcttcttccttgtgaccgagttcctggagcta
ggcggtggcggtggcgggcggcacacaggaccctcgctcgcccagcggctggcgcagctg
cactcgacgcctgcgccgcctgatccggcgacaggccgccggcggttcggcttccccgtc
cccacgttctgcggagacagcaggcagctgaaccggtggcgggactcgtgggcggagttc
tacgcggaggaacggctgctgatgatcctggagcgggcggagcggcggcatgggccggac
ggtgggctgcgggcgctggtggagcggacggcggggacggtggtgccggcgttgctgggg
gagggccatttggggtatgctagggacgggaagggggaggggattgtgccggtggtggtg
catggggatctgtggagtgggaatgcgggtcggggccggatcgtgggcactgggagtttg
cgtgggcgtgggcgtgggcgtgggcgtgggcgagcgggggacgaggaggaggaggaggag
gtggtagtaggtgacgtggtgtatgacccgtcggcgtgctatgcacatagggagtacgag
ctggggattatgcggatgtttggcgggtttggggcgccgtttttcgaggcgtatcatcgc
attgtgcccaagacggagccggtcgaggagtatgatgaccgggtgcgattgtatgagctg
tatcatcatctgaaccaccatgcgatctttggggctgggtataggtcgggggcagtgtcg
atcatggagaagctgctaaagaaatcaaccccctaccacaacgagcagtcattcctggcc
ctgaacccgcgcggattggtcccaacactgggcgtccatgcaggcgaagatgacaaggcc
atcaagccactctacgagtccaacgtcatccgcgaatacctcaaggacgcatacccagac
caccagccgcgtctgcttccgtccgattcctacgagaaagcccgcgcccggatcttgatg
gactttgtgagctcgcggagactgccaaaggatcaactttcctttcctgatttggctctg
gcgccctgggcggtgcggttgtgggcctttgatgggttgaagactggtggtctgggaatt
cctgctgagggacaggaaggagaggataaagctgtctggcagcggtggaggaagtggctc
agggctgtggaggagagggagggtgtaaaggcaaccaccagtgagaagggtcattacttg
ccaatctatacccgctatgcagagaatactgcccagagtgagttggccaaggcgaccaga
gctggaaccggagtaccttga

DBGET integrated database retrieval system