KEGG   Aspergillus clavatus: ACLA_029870Help
Entry
ACLA_029870       CDS       T01148                                 

Definition
(RefSeq) protein phosphatase PP1 regulatory subunit Sds22, putative
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:act01009]
    ACLA_029870
Protein phosphatases and associated proteins [BR:act01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ACLA_029870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 4700743
NCBI-ProteinID: XP_001269680
UniProt: A1CRI3
LinkDB All DBs
AA seq 351 aa AA seqDB search
MKDSKGWDGKLRVEPKATITNPEALEDPEYSDSDAPPVEEIEADEDLLEDEDRDTPDIDL
VHCRIRSIPALRLERFTKLQRICLRQNQITRIEFPSEIAPTMLELDLYDNLISHMRGLDD
FRDLTSLDLSFNKIKHIKNISHLVHLTDLYFVQDRISKIEGLEGLTKLRNLELGANRIRE
IENLETLAALEELWLGKNKITEMKNLDALSNLRIISIQSNRLTSITGLSSLQNLEELYLS
HNAITDLSGLESNTALRVLDFSNNQVSKLEHISHLKNLEELWASNNQLASFEEVERELKD
TKTLNTVYFEGNPLQTKGPAVYRNKVRLALPQIMQIDASKFGLKLYEENGG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacagcaaaggctgggatgggaagctgagggtggaaccaaaagccacgatcacg
aaccctgaggctctggaggatccggagtattcggactcggatgcgccgccggtggaggaa
atcgaggccgatgaggacttgcttgaggatgaggatagagacactccggacatcgatctc
gtacattgtcgcatccgatctatcccagctcttcggttagagcgatttaccaagttgcag
agaatatgcctccgacaaaaccagattacgcgcatcgagtttccctcggagatcgcgccg
acgatgctcgagctcgacttatacgataacctcatctcgcatatgcggggtctcgacgac
ttccgggacctgacgagtctcgatctgagcttcaacaagatcaagcatatcaagaacatc
tcgcatctggtgcatctgacggatttgtactttgtgcaggaccggatatcgaagattgag
gggctggaggggctgaccaagttgcggaatttggagctgggggcgaataggatccgggaa
atcgagaacctggagactctggccgcgctggaggagctgtggctggggaagaacaagatc
actgagatgaagaacctcgacgcgctctcgaacctccgcatcatctccatccaatcgaac
cgactcaccagcatcaccggcctctcctctctccagaacctcgaagaactctacctatcg
cacaacgccatcacggacctcagcggcctcgagtcgaataccgcgctacgcgtcctggat
ttctctaacaatcaggtctcgaagctggaacacatctcgcacctgaagaacctggaggaa
ctgtgggcatcgaacaaccagctcgccagctttgaggaggtggagcgcgagctgaaggat
acaaagactctcaatacggtgtatttcgaggggaacccgttgcagaccaagggcccggcg
gtatatcggaataaggtgcggttggcgctgccgcagatcatgcaaattgatgcgagtaag
tttgggctgaaattatatgaagagaatggaggctaa

DBGET integrated database retrieval system