KEGG   Aspergillus clavatus: ACLA_035740Help
Entry
ACLA_035740       CDS       T01148                                 

Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
act  Aspergillus clavatus
Pathway
act00020  Citrate cycle (TCA cycle)
act00190  Oxidative phosphorylation
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
act01200  Carbon metabolism
Module
act_M00009  Citrate cycle (TCA cycle, Krebs cycle)
act_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
act_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACLA_035740
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ACLA_035740
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ACLA_035740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 4703184
NCBI-ProteinID: XP_001270797
UniProt: A1CJP7
LinkDB All DBs
AA seq 647 aa AA seqDB search
MSSLSLRSLAPASKISRALRDQRRLFSSTRPAARIFANRPLRAKEATGFIAEKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFKTACVSKLFPTRSHTVAAQGGINAALGNMHPDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFSRTEDGLIYQRAFGGQSKEFG
KGGQAYRCCAVADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEDGECRGIIAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEK
DHIYLQLSHLPAELLHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDEQGKDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHRVRDIATPGQP
HRELSADAGAQSIKDLDFVRNAEGPKSTFDIRNAMQKTMQTDVSVFRTQESLDEGVEKIT
AIDQLFDQVGTKDRSMIWNSDLVETLELRNLLTCASQTAVAAANRKESRGAHAREDYPDR
DDENWMKHTLTWQKNPHGKVDLSYRAVEHNTLDENECKSVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctgagcttgcggagcctagctcccgcctccaagatttcccgtgctcttcgg
gatcagagacgtcttttctcctcgacacgccctgcagcccgcatcttcgccaaccggcca
ctgcgcgctaaggaggccactggtttcatcgccgagaagtatcccgtcattgaccacgaa
tacgatgccgtcgtcgtcggtgctggtggtgccggtctgcgtgccgccttcggtctggcg
gaagctggtttcaaaactgcctgtgtctccaaactgttccctactagaagtcacactgtt
gccgctcagggtggtatcaatgctgctctcggaaacatgcaccccgatgactggagatgg
cacatgtacgacacagtgaagggctccgattggcttggtgatcaagatgccattcactac
atgaccagagaggctcccgcttctgtccgtgagcttgagggttatggatgccccttctcc
cgtaccgaggatggtctgatctaccagcgtgcctttggtggtcagtcgaaggagttcggc
aagggcggtcaggcctaccgttgctgcgccgtcgctgatcgtaccggtcacgctcttctg
cacactctctacggacagtctctgcgccacaacaccaactacttcatcgaatacttcgcc
ctggatctgctgatggaggatggtgagtgccgcggtatcatcgcctacaaccaggaggac
ggcaccctgcaccgcttcaaggcccaccacactgtcctggccaccggtggttacggacgt
gcctacttcagctgcacttctgcccacacttgcaccggtgacggtatggctatggtcgcc
cgtgctggtcttcctaaccaggatcttgagttcgtccagttccaccccactggtatctac
ggtgctggttgcctgatcaccgagggttctcgtggtgagggtggttacctgctcaactcc
gagggtgagcgtttcatggagcgttatgctcctaccgccaaggatctcgcctcccgtgac
gttgtctctcgttccatgaccatggaaatccgtgagggccgtggtgttggtcccgagaag
gatcacatctacctgcagctgagccatctgcccgctgagctgctgcacgagcgtctcccc
ggtatctcggagaccgcctccattttcgccggtgttgatgttaccaagcagcccattccc
gtcctccccaccgtccactacaacatgggtggtatccccactaagtacaccggtgaggtc
ctgaccgttgacgagcagggcaaggacaaggttgttcctggtctgtacgcctgtggtgag
gccgcctgtgtctccgtccacggtgccaaccgtctgggtgccaactctctgctcgatctc
gttgtcttcggtcgtgccgtctcccaccgtgtccgcgacattgctacccccggccagcct
caccgtgagctgagcgccgacgccggtgcccagtccatcaaggatctcgactttgtccgc
aacgccgagggtcccaagtcgaccttcgacatccgtaacgccatgcagaagaccatgcag
actgacgtcagcgtcttccgtacccaggagagtttggacgagggtgtcgagaagatcacc
gccattgaccagctgttcgaccaagtcggtaccaaggaccgcagcatgatctggaactcg
gaccttgttgagactcttgagcttcgtaacctgctgacctgcgcttcccaaaccgccgtt
gccgccgctaaccgcaaggagtcccgtggtgctcacgcccgtgaggattaccctgaccgt
gatgacgagaactggatgaagcacaccctcacctggcagaagaacccccacggcaaggtc
gacctaagctaccgcgccgttgagcacaacactcttgatgagaacgagtgcaagagcgtg
cctcctttcaagcgtgtctactaa

DBGET integrated database retrieval system