KEGG   Aspergillus clavatus: ACLA_036650Help
Entry
ACLA_036650       CDS       T01148                                 

Definition
(RefSeq) isocitrate dehydrogenase Idp1, putative
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
act  Aspergillus clavatus
Pathway
act00020  Citrate cycle (TCA cycle)
act00480  Glutathione metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
act01200  Carbon metabolism
act01210  2-Oxocarboxylic acid metabolism
act01230  Biosynthesis of amino acids
act04146  Peroxisome
Module
act_M00009  Citrate cycle (TCA cycle, Krebs cycle)
act_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACLA_036650
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACLA_036650
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ACLA_036650
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ACLA_036650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 4702963
NCBI-ProteinID: XP_001270886
UniProt: A1CJY6
LinkDB All DBs
AA seq 419 aa AA seqDB search
MATEGTKIKVKNPVVELDGDEMTRIIWQEIKEKVSCPFYLDIDLKYYDLGIEYRDQTDDK
VTVDAAEAIKKYGVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNILGGTVFREPIVID
RIPRLVPGWTKPIIIGRHAFGDQYRAADRVIPGPGKLELVYTPKGGEPESITVYDFPGGG
VAQTQYNTDESIRGFAHSSFQMALMKGLPLYMSTKNTILKRYDGRFKDIFQEIYEADYQK
EFEAKGIWYEHRLIDDMVAQMIKSEGGFVMALKNYDGDVQSDIVAQGFGSLGLMTSTLTT
PTGEAFESEAAHGTVTRHYREHQKGRETSTNPIASIFAWTRGLIQRGKLDETPDVVAFAE
ELERACIDVVNDGVMTKDLALACGRKDREAWVTTKEYMAAVERQLKSNLKARLMRAFLE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaaggtactaagatcaaggtcaagaacccagtcgtcgagctggacggtgat
gagatgacccgtatcatctggcaggaaatcaaagaaaaagtaagttgccccttttacctt
gacattgatctcaagtactacgacttgggtattgagtaccgtgaccagaccgatgacaag
gtcaccgtcgacgctgctgaggccatcaagaagtatggtgttggtgtcaagtgtgctacc
atcactcccgatgaggctcgtgttgaggagttcaagctgaagaagatgtggctctctccc
aacggtaccatcagaaacatccttggtggaaccgtgttccgtgaacccattgtcatcgac
cgtatcccccgtcttgttcccggatggaccaagcccatcatcattggccgtcacgccttt
ggtgatcagtaccgtgctgccgaccgtgtcatccctggccccggcaagctcgagctggtc
tacactcccaagggcggcgagcccgagtcgatcaccgtctacgacttccccggcggtggt
gttgctcagactcagtacaacactgacgagtccattcgcggcttcgcccactccagcttc
cagatggccctgatgaagggacttcctctgtacatgagcaccaagaataccatcctcaag
agatacgatggccgcttcaaggacatcttccaggagatctatgaggccgactaccagaag
gaattcgaggctaagggcatctggtacgagcaccgtctcatcgatgacatggttgcccag
atgattaagagcgagggcggtttcgttatggctctgaagaactatgacggtgacgttcag
tctgatatcgtcgctcagggcttcggctcccttggtctgatgacctccactctcaccacc
cctaccggtgaggcctttgagtccgaggctgcccacggcacggtcacccgtcactaccgt
gagcaccagaagggccgtgagacctccaccaaccctattgcctcgatctttgcctggacc
cgtggcctgatccagcgtggtaagctcgacgagacccccgacgttgttgccttcgccgag
gagcttgagcgtgcttgcattgatgttgtcaatgacggcgttatgaccaaggatctggcc
ctggcctgcggccgcaaggatcgtgaggcttgggttaccaccaaggagtacatggctgct
gttgagcgccaactcaagtccaacctcaaggcccgactcatgagggcttttctggaatag

DBGET integrated database retrieval system